Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Virus PS/HR protein

This Virus PS/HR protein spans the amino acid sequence from region 18-279aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Plaque-size/host range protein

UniProt

P21115

Expression Region

18-279aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Origin

Vaccinia virus (strain Copenhagen) (VACV)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

YSTCTVPTMNNAKLTSTETSFNNNQKVTFTCDQGYHSSDPNAVCETDKWKYENPCKKMCTVSDYISELYNKPLYEVNSTMTLSCNGETKYFRCEEKNGNTSWNDTVTCPNAECQPLQLEHGSCQPVKEKYSFGEYMTINCDVGYEVIGASYISCTANSWNVIPSCQQKCDIPSLSNGLISGSTFSIGGVIHLSCKSGFILTGSPSSTCIDGKWNPVLPICVRTNEEFDPVDDGPDDETDLSKLSKDVVQYEQEIESLEATYH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DEFB109P3 Protein Vector (Human) (pPB-C-His)
PV072697 500 ng

DEFB109P3 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
USP3, NT (Ubiquitin Carboxyl-terminal Hydrolase 3, Ubiquitin Thiolesterase 3, Ubiquitin-specific-processing Protease 3, Deubiquitinating Enzyme 3) (Azide free) (HRP) discontinued
U4099-70B-HRP 200 µL

USP3, NT (Ubiquitin Carboxyl-terminal Hydrolase 3, Ubiquitin Thiolesterase 3, Ubiquitin-specific-processing Protease 3, Deubiquitinating Enzyme 3) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
Phospho-GRAP2 (Thr262) Antibody
AF4322-01 100 µL

Phospho-GRAP2 (Thr262) Antibody

Sign In for Pricing
View Details
Phospho-GRAP2 (Thr262) Antibody
AF4322-02 200 µL

Phospho-GRAP2 (Thr262) Antibody

Sign In for Pricing
View Details
Mouse Abhd3 Pre-designed siRNA Set A
SI100082A 1 Each

Mouse Abhd3 Pre-designed siRNA Set A

Sign In for Pricing
View Details
PDE4D siRNA (Rat)
orb1833686-01 15 nmol

PDE4D siRNA (Rat)

Sign In for Pricing
View Details