Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PLA2G12A protein

This Human PLA2G12A protein spans the amino acid sequence from region 23-189aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Phosphatidylcholine 2-acylhydrolase 12A (GXII sPLA2) (sPLA2-XII) (PLA2G12)

UniProt

Q9BZM1

Expression Region

23-189aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QEQAQTTDWRATLKTIRNGVHKIDTYLNAALDLLGGEDGLCQYKCSDGSKPFPRYGYKPSPPNGCGSPLFGVHLNIGIPSLTKCCNQHDRCYETCGKSKNDCDEEFQYCLSKICRDVQKTLGLTQHVQACETTVELLFDSVIHLGCKPYLDSQRAACRCHYEEKTDL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

BATF Antibody
E38PA3796 100 µL

BATF Antibody

Sign In for Pricing
View Details
ASB2 Human siRNA Oligo Duplex (Locus ID 51676)
SR309911 1 Kit

ASB2 Human siRNA Oligo Duplex (Locus ID 51676)

Sign In for Pricing
View Details
Mouse Monoclonal UBA52 Antibody (OTI4E1) [DyLight 680]
NBP2-74729FR 0.1 mL

Mouse Monoclonal UBA52 Antibody (OTI4E1) [DyLight 680]

Sign In for Pricing
View Details
Uncx Rabbit Polyclonal Antibody (FITC)
orb2130793 100 µL

Uncx Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
MTR Rabbit pAb, Pacific Blue conjugated
orb2848849 100 µL

MTR Rabbit pAb, Pacific Blue conjugated

Sign In for Pricing
View Details
ARFRP1 Human shRNA Plasmid Kit (Locus ID 10139)
TL314694 1 Kit

ARFRP1 Human shRNA Plasmid Kit (Locus ID 10139)

Sign In for Pricing
View Details