Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PLA2G12A protein

This Human PLA2G12A protein spans the amino acid sequence from region 23-189aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Phosphatidylcholine 2-acylhydrolase 12A (GXII sPLA2) (sPLA2-XII) (PLA2G12)

UniProt

Q9BZM1

Expression Region

23-189aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QEQAQTTDWRATLKTIRNGVHKIDTYLNAALDLLGGEDGLCQYKCSDGSKPFPRYGYKPSPPNGCGSPLFGVHLNIGIPSLTKCCNQHDRCYETCGKSKNDCDEEFQYCLSKICRDVQKTLGLTQHVQACETTVELLFDSVIHLGCKPYLDSQRAACRCHYEEKTDL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cnksr1 siRNA Oligos set (Rat)
16461176 3x 5 nmol

Cnksr1 siRNA Oligos set (Rat)

Sign In for Pricing
View Details
Human IQUB knockdown cell line
ABC-KD7459 1 Vial

Human IQUB knockdown cell line

Sign In for Pricing
View Details
FERMT1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K0774908 1.0 µg DNA

FERMT1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
RPL26L1 Antibody
A42824-100UL 100 µL

RPL26L1 Antibody

Sign In for Pricing
View Details
Anti Mouse CD73 Flow Cytometry Monoclonal Clone TY23 Biotin 100ug
IRTAMSCD73TY23CBL100UG 100 µg

Anti Mouse CD73 Flow Cytometry Monoclonal Clone TY23 Biotin 100ug

Sign In for Pricing
View Details
PAX8 antibody - N-terminal region
OAEB02411-100UG 100 µg

PAX8 antibody - N-terminal region

Sign In for Pricing
View Details