Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PLA2G12A protein

This Human PLA2G12A protein spans the amino acid sequence from region 23-189aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Phosphatidylcholine 2-acylhydrolase 12A (GXII sPLA2) (sPLA2-XII) (PLA2G12)

UniProt

Q9BZM1

Expression Region

23-189aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QEQAQTTDWRATLKTIRNGVHKIDTYLNAALDLLGGEDGLCQYKCSDGSKPFPRYGYKPSPPNGCGSPLFGVHLNIGIPSLTKCCNQHDRCYETCGKSKNDCDEEFQYCLSKICRDVQKTLGLTQHVQACETTVELLFDSVIHLGCKPYLDSQRAACRCHYEEKTDL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal UNC5H1/Unc5a Antibody [Alexa Fluor 350]
NBP3-00125AF350 0.1 mL

Rabbit Polyclonal UNC5H1/Unc5a Antibody [Alexa Fluor 350]

Sign In for Pricing
View Details
Anti-TULP3 Antibody Picoband®, Carrier-free
A09384-2-carrier-free 100 µg/Vial

Anti-TULP3 Antibody Picoband®, Carrier-free

Sign In for Pricing
View Details
Rbm46 ORF Vector (Mouse) (pORF)
38638014 1.0 µg DNA

Rbm46 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
RAD51D Rabbit Polyclonal Antibody (Biotin)
orb2082544 100 µL

RAD51D Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
ACSS2 Peptide - C-terminal region
MBS3240010-01 0.1 mg

ACSS2 Peptide - C-terminal region

Sign In for Pricing
View Details
ACSS2 Peptide - C-terminal region
MBS3240010-02 5x 0.1 mg

ACSS2 Peptide - C-terminal region

Sign In for Pricing
View Details