Human ANGPTL8 protein
This Human ANGPTL8 protein spans the amino acid sequence from region 22-198aa. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Betatrophin (Lipasin) (Refeeding-induced fat and liver protein) (C19orf80) (RIFL)
UniProt
Q6UXH0
Expression Region
22-198aa
Tag
N-terminal 10xHis-tagged
Source
Baculovirus
Origin
Homo sapiens (Human)
Field of Research
Metabolism Research
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
22.4 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Full Length of Mature Protein
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
APMGGPELAQHEELTLLFHGTLQLGQALNGVYRTTEGRLTKARNSLGLYGRTIELLGQEVSRGRDAAQELRASLLETQMEEDILQLQAEATAEVLGEVAQAQKVLRDSVQRLEVQLRSAWLGPAYREFEVLKAHADKQSHILWALTGHVQRQRREMVAQQHRLRQIQERLHTAALPA
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6240489-01 0.1 mL
SERPINB10 (Serpin Peptidase Inhibitor, Clade B (ovalbumin), Member 10, PI10, bomapin) (MaxLight 750)
Sign In for Pricing
View Details MBS6240489-02 5x 0.1 mL
SERPINB10 (Serpin Peptidase Inhibitor, Clade B (ovalbumin), Member 10, PI10, bomapin) (MaxLight 750)
Sign In for Pricing
View Details 
TU077265 1x106 cells / 1.0 mL
TRPM7 3'UTR GFP Stable Cell Line
Sign In for Pricing
View Details MBS7012018-01 0.02 mg
Recombinant Brucella abortus Cobalamin synthase (cobS)
Sign In for Pricing
View Details MBS7012018-02 0.1 mg
Recombinant Brucella abortus Cobalamin synthase (cobS)
Sign In for Pricing
View Details