Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ANGPTL8 protein

This Human ANGPTL8 protein spans the amino acid sequence from region 22-198aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Betatrophin (Lipasin) (Refeeding-induced fat and liver protein) (C19orf80) (RIFL)

UniProt

Q6UXH0

Expression Region

22-198aa

Tag

N-terminal 10xHis-tagged

Source

Baculovirus

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

APMGGPELAQHEELTLLFHGTLQLGQALNGVYRTTEGRLTKARNSLGLYGRTIELLGQEVSRGRDAAQELRASLLETQMEEDILQLQAEATAEVLGEVAQAQKVLRDSVQRLEVQLRSAWLGPAYREFEVLKAHADKQSHILWALTGHVQRQRREMVAQQHRLRQIQERLHTAALPA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IGBP1 Protein Vector (Mouse) (pPM-C-HA)
PV190876 500 ng

IGBP1 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
NKX3.1 Antibody
V8254-20UG 20 µg

NKX3.1 Antibody

Sign In for Pricing
View Details
Mouse APCS protein
orb391241-01 10 µg

Mouse APCS protein

Sign In for Pricing
View Details
Mouse APCS protein
orb391241-02 50 µg

Mouse APCS protein

Sign In for Pricing
View Details
Mouse APCS protein
orb391241-03 500 µg

Mouse APCS protein

Sign In for Pricing
View Details
DVL1 Antibody (Center)
MBS9232183-01 0.1 mL

DVL1 Antibody (Center)

Sign In for Pricing
View Details