Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Zebrafish hsp90a.1 protein

This Zebrafish hsp90a.1 protein spans the amino acid sequence from region 151-355aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Hsp90 (hsp90a) (hsp90aa1)

UniProt

Q90474

Expression Region

151-355aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

HNDDEQYIWESAAGGSFTVKPDFGESIGRGTKVILHLKEDQSEYVEEKRIKEVVKKHSQFIGYPITLYIEKQREKEVDLEEGEKQEEEEVAAGEDKDKPKIEDLGADEDEDSKDGKNKRKKKVKEKYIDAQELNKTKPIWTRNPDDITNEEYGEFYKSLSNDWEDHLAVKHFSVEGQLEFRALLFVPRRAAFDLFENKKKRNNIK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RbAp48 (RBBP4) Human Knockdown Lysate
LY300419 100 µg

RbAp48 (RBBP4) Human Knockdown Lysate

Sign In for Pricing
View Details
CD117 / c-Kit (Marker for Gastrointestinal Stromal Tumors) (KIT/2670), CF568 conjugate, 0.1mg/mL
BNC682670-500 1x 500 µL

CD117 / c-Kit (Marker for Gastrointestinal Stromal Tumors) (KIT/2670), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
EASYStep Pro Mouse Estriol (E3) ELISA Kit
RDEp-E3-Mu 96 Tests

EASYStep Pro Mouse Estriol (E3) ELISA Kit

Sign In for Pricing
View Details
UBQLNL Polyclonal Antibody
E-AB-66286-01 60 µL

UBQLNL Polyclonal Antibody

Sign In for Pricing
View Details
UBQLNL Polyclonal Antibody
E-AB-66286-02 120 µL

UBQLNL Polyclonal Antibody

Sign In for Pricing
View Details
UBQLNL Polyclonal Antibody
E-AB-66286-03 200 µL

UBQLNL Polyclonal Antibody

Sign In for Pricing
View Details