Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human COL6A2 protein

This Human COL6A2 protein spans the amino acid sequence from region 941-1016aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CO6A2_HUMAN, COL6A2, Collagen alpha 2 (VI) chain, Collagen alpha-2 (VI) chain, collagen type VI alpha 2, Collagen VI alpha 2 polypeptide, human mRNA for collagen VI alpha 2 C terminal globular domain, PP3610

UniProt

P12110

Expression Region

941-1016aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

37.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ELSFVFLTDGVTGNDSLHESAHSMRKQNVVPTVLALGSDVDMDVLTTLSLGDRAAVFHEKDYDSLAQPGFFDRFIR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SOCS3 Rabbit Polyclonal Antibody
orb2952768-01 50 µg

SOCS3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SOCS3 Rabbit Polyclonal Antibody
orb2952768-02 100 µg

SOCS3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
IL17RC Human Over-expression Lysate
orb1372087 20 µg

IL17RC Human Over-expression Lysate

Sign In for Pricing
View Details
STYK1 (Serine/threonine/tyrosine Kinase 1, Tyrosine-protein Kinase STYK1, Novel Oncogene with Kinase Domain, NOK, Protein PK-unique, SuRTK106) (Not for Export EU)
134053 100 µL

STYK1 (Serine/threonine/tyrosine Kinase 1, Tyrosine-protein Kinase STYK1, Novel Oncogene with Kinase Domain, NOK, Protein PK-unique, SuRTK106) (Not for Export EU)

Sign In for Pricing
View Details
N3- (Benzyl-D7) -Adenine
CS-T-102754 1 Each

N3- (Benzyl-D7) -Adenine

Sign In for Pricing
View Details
LsrK Antibody
orb820413 2 mg

LsrK Antibody

Sign In for Pricing
View Details