Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human COL6A2 protein

This Human COL6A2 protein spans the amino acid sequence from region 941-1016aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CO6A2_HUMAN, COL6A2, Collagen alpha 2 (VI) chain, Collagen alpha-2 (VI) chain, collagen type VI alpha 2, Collagen VI alpha 2 polypeptide, human mRNA for collagen VI alpha 2 C terminal globular domain, PP3610

UniProt

P12110

Expression Region

941-1016aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

37.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ELSFVFLTDGVTGNDSLHESAHSMRKQNVVPTVLALGSDVDMDVLTTLSLGDRAAVFHEKDYDSLAQPGFFDRFIR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EDNRB Mouse Monoclonal Antibody (Fluoro550)
orb3085458 100 µg

EDNRB Mouse Monoclonal Antibody (Fluoro550)

Sign In for Pricing
View Details
ITGB3 Monoclonal Antibody
CSB-MA110588 100 µL

ITGB3 Monoclonal Antibody

Sign In for Pricing
View Details
CEACAM1 Rabbit Polyclonal Antibody (FITC)
orb2590108 100 µg

CEACAM1 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
500L Plant Growth Chamber
Terra500PC 1 Each

500L Plant Growth Chamber

Sign In for Pricing
View Details
CHO host cell protein ELISA kit
ENZ-KIT128-0001 96 Well

CHO host cell protein ELISA kit

Sign In for Pricing
View Details
Selm Protein Vector (Mouse) (pPB-C-His)
PV227550 500 ng

Selm Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details