Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human C1QTNF3 protein

This Human C1QTNF3 protein spans the amino acid sequence from region 23-246aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Collagenous repeat-containing sequence 26 kDa protein (CORS26) (Secretory protein CORS26) (CTRP3)

UniProt

Q9BXJ4

Expression Region

23-246aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QDEYMESPQTGGLPPDCSKCCHGDYSFRGYQGPPGPPGPPGIPGNHGNNGNNGATGHEGAKGEKGDKGDLGPRGERGQHGPKGEKGYPGIPPELQIAFMASLATHFSNQNSGIIFSSVETNIGNFFDVMTGRFGAPVSGVYFFTFSMMKHEDVEEVYVYLMHNGNTVFSMYSYEMKGKSDTSSNHAVLKLAKGDEVWLRMGNGALHGDHQRFSTFAGFLLFETK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monoclonal Anti-Monkeypox-A30L Antibody, Human IgG1 (8A2) (MALS & SPR verified)
A3L-M572-100ug 100 µg

Monoclonal Anti-Monkeypox-A30L Antibody, Human IgG1 (8A2) (MALS & SPR verified)

Sign In for Pricing
View Details
AKT1 Rabbit Polyclonal Antibody
AP06620PU-N 100 µg

AKT1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Atg13 Mouse Gene Knockout Kit (CRISPR)
KN501729 1 Kit

Atg13 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
KCNH2 (NM_000238) Human Over-expression Lysate
LY400090 100 µg

KCNH2 (NM_000238) Human Over-expression Lysate

Sign In for Pricing
View Details
Complement C4d (C4D205), CF568 conjugate, 0.1mg/mL
BNC680205-500 1x 500 µL

Complement C4d (C4D205), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
4930523C07Rik Mouse Gene Knockout Kit (CRISPR)
KN500388 1 Kit

4930523C07Rik Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details