Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human C1QTNF3 protein

This Human C1QTNF3 protein spans the amino acid sequence from region 23-246aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Collagenous repeat-containing sequence 26 kDa protein (CORS26) (Secretory protein CORS26) (CTRP3)

UniProt

Q9BXJ4

Expression Region

23-246aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QDEYMESPQTGGLPPDCSKCCHGDYSFRGYQGPPGPPGPPGIPGNHGNNGNNGATGHEGAKGEKGDKGDLGPRGERGQHGPKGEKGYPGIPPELQIAFMASLATHFSNQNSGIIFSSVETNIGNFFDVMTGRFGAPVSGVYFFTFSMMKHEDVEEVYVYLMHNGNTVFSMYSYEMKGKSDTSSNHAVLKLAKGDEVWLRMGNGALHGDHQRFSTFAGFLLFETK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WT1 (Wilm's Tumor 1) (WT1/857 + 6F-H2), CF568 conjugate, 0.1mg/mL
BNC681138-100 1x 100 µL

WT1 (Wilm's Tumor 1) (WT1/857 + 6F-H2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
UCHL5 Antibody
KC-27301-01 50 μL

UCHL5 Antibody

Sign In for Pricing
View Details
UCHL5 Antibody
KC-27301-02 100 µL

UCHL5 Antibody

Sign In for Pricing
View Details
UCHL5 Antibody
KC-27301-03 1 mL

UCHL5 Antibody

Sign In for Pricing
View Details
Vanillactic Acid-13C3 (>85%)
TRC-V097354-5MG 5 mg

Vanillactic Acid-13C3 (>85%)

Sign In for Pricing
View Details
IL5 (NM_000879) Human Over-expression Lysate
LY424470 100 µg

IL5 (NM_000879) Human Over-expression Lysate

Sign In for Pricing
View Details