Human DNASE1L3 protein
This Human DNASE1L3 protein spans the amino acid sequence from region 21-305aa. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
DNase I homolog protein DHP2 (Deoxyribonuclease I-like 3) (DNase I-like 3) (Liver and spleen DNase) (LS-DNase) (LSD) (DNase gamma) (DHP2) (DNAS1L3)
UniProt
Q13609
Expression Region
21-305aa
Tag
N-terminal 10xHis-tagged
Source
Baculovirus
Origin
Homo sapiens (Human)
Field of Research
Cell Biology
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
35.8 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Full Length of Mature Protein
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
MRICSFNVRSFGESKQEDKNAMDVIVKVIKRCDIILVMEIKDSNNRICPILMEKLNRNSRRGITYNYVISSRLGRNTYKEQYAFLYKEKLVSVKRSYHYHDYQDGDADVFSREPFVVWFQSPHTAVKDFVIIPLHTTPETSVKEIDELVEVYTDVKHRWKAENFIFMGDFNAGCSYVPKKAWKNIRLRTDPRFVWLIGDQEDTTVKKSTNCAYDRIVLRGQEIVSSVVPKSNSVFDFQKAYKLTEEEALDVSDHFPVEFKLQSSRAFTNSKKSVTLRKKTKSKRS
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC400971-100 1x 100 µL
Myeloid-Associated Differentiation Marker (MYADM/971), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details ![Elab Fluor® 488 Anti-Human CD95/Fas Antibody[HFE7A/APO]](https://cdn.genprice.uk/products/763/68dd14a2061270361e7d0e6b/imageurl/e-ab-f1379l.webp)
E-AB-F1379L-01 20 Tests
Elab Fluor® 488 Anti-Human CD95/Fas Antibody[HFE7A/APO]
Sign In for Pricing
View Details E-AB-F1379L-02 100 Tests
Elab Fluor® 488 Anti-Human CD95/Fas Antibody[HFE7A/APO]
Sign In for Pricing
View Details E-AB-F1379L-03 2x 100 Tests
Elab Fluor® 488 Anti-Human CD95/Fas Antibody[HFE7A/APO]
Sign In for Pricing
View Details 
BNC681789-100 1x 100 µL
Human IgG (Immunoglobulin Gamma Heavy Chain) (B-Cell Marker) (rIG266), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 