Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Beta-NGF, Human (HEK293)

Nerve Growth Factor-β (Beta-NGF; NGF) is a neurotrophic factor that regulates neuronal survival and differentiation. NGF is also a seminal plasma protein involved in ovulation and luteinizing. NGF has potential functions in the female reproductive system to help overcome the current problem of early embryo loss[1][2][3]. Beta-NGF Protein, Human (HEK293) is produced by HEK293 cells (S122-R239), with tag free.

Product Specifications

Product Name Alternative

Beta-NGF Protein, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/beta-ngf-protein-human-hek293.html

Purity

98.0

Smiles

SSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVR

Molecular Formula

4803 (Gene_ID) P01138 (S122-R239) (Accession)

Molecular Weight

Approximately 14 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Yue XJ, et al. Over-expression of nerve growth factor-β in human cholangiocarcinoma QBC939 cells promote tumor progression. PLoS One. 2013;8 (4) :e62024. Published 2013 Apr 24.|[2]Castellanos MR, et al. Obtención y caracterización del beta-NGF murino. Aplicación en un modelo de envejecimiento cerebral [Obtention and characterization of murine beta-NGF. Application in a model of cerebral aging]. Rev Neurol. 1998;26 (153) :717-722.|[3]Lipov EG, et al. Possible Reversal of PTSD-Related DNA Methylation by Sympathetic Blockade. J Mol Neurosci. 2017 May;62 (1) :67-72.|[4]Lima FS, et al. Insights into nerve growth factor-β role in bovine reproduction - Review. Theriogenology. 2020 Jul 1;150:288-293.|[5]Otten U, et al. Nerve growth factor induces growth and differentiation of human B lymphocytes. Proc Natl Acad Sci U S A. 1989 Dec;86 (24) :10059-63.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Selenoh (NM_001037279) Mouse Tagged ORF Clone
MG200498 10 µg

Selenoh (NM_001037279) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
p-Nitrophenyl 2-Acetamido-2-deoxy-3-O-(Beta-D-galactopyranosyl)-Beta-D-glucopyranoside
TRC-N501220-2.5MG 2.5 mg

p-Nitrophenyl 2-Acetamido-2-deoxy-3-O-(Beta-D-galactopyranosyl)-Beta-D-glucopyranoside

Sign In for Pricing
View Details
BenchMixer™ Vortexer, 230V
BV1000-E 1 Each

BenchMixer™ Vortexer, 230V

Sign In for Pricing
View Details
Freeze Dryer BFBT-101-B
BFBT-101-B 1 Unit

Freeze Dryer BFBT-101-B

Sign In for Pricing
View Details
PSORS1C2 Human Gene Knockout Kit (CRISPR)
KN423701 1 Kit

PSORS1C2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD45 / LCA (B-Cell Marker) (rPTPRC/1460), CF740 conjugate, 0.1mg/mL
BNC742066-100 1x 100 µL

CD45 / LCA (B-Cell Marker) (rPTPRC/1460), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details