Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Beta-NGF, Human (HEK293)

Nerve Growth Factor-β (Beta-NGF; NGF) is a neurotrophic factor that regulates neuronal survival and differentiation. NGF is also a seminal plasma protein involved in ovulation and luteinizing. NGF has potential functions in the female reproductive system to help overcome the current problem of early embryo loss[1][2][3]. Beta-NGF Protein, Human (HEK293) is produced by HEK293 cells (S122-R239), with tag free.

Product Specifications

Product Name Alternative

Beta-NGF Protein, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/beta-ngf-protein-human-hek293.html

Purity

98.0

Smiles

SSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVR

Molecular Formula

4803 (Gene_ID) P01138 (S122-R239) (Accession)

Molecular Weight

Approximately 14 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Yue XJ, et al. Over-expression of nerve growth factor-β in human cholangiocarcinoma QBC939 cells promote tumor progression. PLoS One. 2013;8 (4) :e62024. Published 2013 Apr 24.|[2]Castellanos MR, et al. Obtención y caracterización del beta-NGF murino. Aplicación en un modelo de envejecimiento cerebral [Obtention and characterization of murine beta-NGF. Application in a model of cerebral aging]. Rev Neurol. 1998;26 (153) :717-722.|[3]Lipov EG, et al. Possible Reversal of PTSD-Related DNA Methylation by Sympathetic Blockade. J Mol Neurosci. 2017 May;62 (1) :67-72.|[4]Lima FS, et al. Insights into nerve growth factor-β role in bovine reproduction - Review. Theriogenology. 2020 Jul 1;150:288-293.|[5]Otten U, et al. Nerve growth factor induces growth and differentiation of human B lymphocytes. Proc Natl Acad Sci U S A. 1989 Dec;86 (24) :10059-63.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SCAS
#70037 1x 100 mg

SCAS

Sign In for Pricing
View Details
Human IgG4 (Ig Heavy Constant Gamma 4) (G4m Marker) (rIGHG4/1345), 1mg/mL
BNUM2284-50 1x 50 µL

Human IgG4 (Ig Heavy Constant Gamma 4) (G4m Marker) (rIGHG4/1345), 1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Blocks, Colon
CB519558 1 Block

Frozen Tissue Blocks, Colon

Sign In for Pricing
View Details
CAB39 (NM_001130849) Human Recombinant Protein
TP325504M 100 µg

CAB39 (NM_001130849) Human Recombinant Protein

Sign In for Pricing
View Details
Human Pancreatic Stellate CAFs
CAF08 1000000 Cells

Human Pancreatic Stellate CAFs

Sign In for Pricing
View Details
CoverGripTM Coverslip Sealant Refill
#23005-1 1x 100 mL

CoverGripTM Coverslip Sealant Refill

Sign In for Pricing
View Details