Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Beta-NGF, Human (HEK293)

Nerve Growth Factor-β (Beta-NGF; NGF) is a neurotrophic factor that regulates neuronal survival and differentiation. NGF is also a seminal plasma protein involved in ovulation and luteinizing. NGF has potential functions in the female reproductive system to help overcome the current problem of early embryo loss[1][2][3]. Beta-NGF Protein, Human (HEK293) is produced by HEK293 cells (S122-R239), with tag free.

Product Specifications

Product Name Alternative

Beta-NGF Protein, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/beta-ngf-protein-human-hek293.html

Purity

98.0

Smiles

SSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVR

Molecular Formula

4803 (Gene_ID) P01138 (S122-R239) (Accession)

Molecular Weight

Approximately 14 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Yue XJ, et al. Over-expression of nerve growth factor-β in human cholangiocarcinoma QBC939 cells promote tumor progression. PLoS One. 2013;8 (4) :e62024. Published 2013 Apr 24.|[2]Castellanos MR, et al. Obtención y caracterización del beta-NGF murino. Aplicación en un modelo de envejecimiento cerebral [Obtention and characterization of murine beta-NGF. Application in a model of cerebral aging]. Rev Neurol. 1998;26 (153) :717-722.|[3]Lipov EG, et al. Possible Reversal of PTSD-Related DNA Methylation by Sympathetic Blockade. J Mol Neurosci. 2017 May;62 (1) :67-72.|[4]Lima FS, et al. Insights into nerve growth factor-β role in bovine reproduction - Review. Theriogenology. 2020 Jul 1;150:288-293.|[5]Otten U, et al. Nerve growth factor induces growth and differentiation of human B lymphocytes. Proc Natl Acad Sci U S A. 1989 Dec;86 (24) :10059-63.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OPA3 Rabbit pAb
E2507997 100 µL

OPA3 Rabbit pAb

Sign In for Pricing
View Details
Sphingosine 1 Phosphate Receptor 1 (S1PR1) Antibody (Biotin)
abx305228-01 20 µg

Sphingosine 1 Phosphate Receptor 1 (S1PR1) Antibody (Biotin)

Sign In for Pricing
View Details
Sphingosine 1 Phosphate Receptor 1 (S1PR1) Antibody (Biotin)
abx305228-02 50 µg

Sphingosine 1 Phosphate Receptor 1 (S1PR1) Antibody (Biotin)

Sign In for Pricing
View Details
Sphingosine 1 Phosphate Receptor 1 (S1PR1) Antibody (Biotin)
abx305228-03 100 µg

Sphingosine 1 Phosphate Receptor 1 (S1PR1) Antibody (Biotin)

Sign In for Pricing
View Details
Sphingosine 1 Phosphate Receptor 1 (S1PR1) Antibody (Biotin)
abx305228-04 200 µg

Sphingosine 1 Phosphate Receptor 1 (S1PR1) Antibody (Biotin)

Sign In for Pricing
View Details
Sphingosine 1 Phosphate Receptor 1 (S1PR1) Antibody (Biotin)
abx305228-05 1 mg

Sphingosine 1 Phosphate Receptor 1 (S1PR1) Antibody (Biotin)

Sign In for Pricing
View Details