Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD59, Rat (HEK293, His)

The CD59 protein is a potent inhibitor of the complement membrane attack complex (MAC) and exerts regulatory control at or after the C5b-8 stage.Its critical role makes CD59 a key regulator in the complement system, preventing overactivation and associated membrane damage.CD59 Protein, Rat (HEK293, His) is the recombinant rat-derived CD59 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD59 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd59-protein-rat-hek293-his.html

Purity

96.00

Smiles

LRCYNCLDPVSSCKTNSTCSPNLDACLVAVSGKQVYQQCWRFSDCNAKFILSRLEIANVQYRCCQADLCNKSFEDKPN

Molecular Formula

25407 (Gene_ID) P27274 (L23-N100) (Accession)

Molecular Weight

Approximately 14-16 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Syndig1l (NM_001109485) Rat Tagged Lenti ORF Clone
RR204263L3 10 µg

Syndig1l (NM_001109485) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Ints6 Mouse Gene Knockout Kit (CRISPR)
KN508373 1 Kit

Ints6 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Rabbit Polyclonal PAOX Antibody
NBP1-70666 100 µL

Rabbit Polyclonal PAOX Antibody

Sign In for Pricing
View Details
Rabbit Pancreatic Acinar Epithelial Cells
AFG-ELL-2276 > 5x 10^5 Cells / Vial

Rabbit Pancreatic Acinar Epithelial Cells

Sign In for Pricing
View Details
Transmembrane protein 136 (TMEM136) Human ELISA Kit
H8223 96 Tests

Transmembrane protein 136 (TMEM136) Human ELISA Kit

Sign In for Pricing
View Details
Monkey PRCP (Prolylcarboxypeptidase) ELISA Kit
MBS2509535-01 24 Tests

Monkey PRCP (Prolylcarboxypeptidase) ELISA Kit

Sign In for Pricing
View Details