Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD59, Rat (HEK293, His)

The CD59 protein is a potent inhibitor of the complement membrane attack complex (MAC) and exerts regulatory control at or after the C5b-8 stage.Its critical role makes CD59 a key regulator in the complement system, preventing overactivation and associated membrane damage.CD59 Protein, Rat (HEK293, His) is the recombinant rat-derived CD59 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD59 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd59-protein-rat-hek293-his.html

Purity

96.00

Smiles

LRCYNCLDPVSSCKTNSTCSPNLDACLVAVSGKQVYQQCWRFSDCNAKFILSRLEIANVQYRCCQADLCNKSFEDKPN

Molecular Formula

25407 (Gene_ID) P27274 (L23-N100) (Accession)

Molecular Weight

Approximately 14-16 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CLN3 (Battenin, Batten Disease Protein, Protein CLN3, BTS) (MaxLight 650)
MBS6221535-01 0.1 mL

CLN3 (Battenin, Batten Disease Protein, Protein CLN3, BTS) (MaxLight 650)

Sign In for Pricing
View Details
CLN3 (Battenin, Batten Disease Protein, Protein CLN3, BTS) (MaxLight 650)
MBS6221535-02 5x 0.1 mL

CLN3 (Battenin, Batten Disease Protein, Protein CLN3, BTS) (MaxLight 650)

Sign In for Pricing
View Details
Edudiol
MF-0023908-01 1 mg

Edudiol

Sign In for Pricing
View Details
Edudiol
MF-0023908-02 5 mg

Edudiol

Sign In for Pricing
View Details
PCMV-mCherry-IRGM (human) -Neo
BZ58318 1 Vial

PCMV-mCherry-IRGM (human) -Neo

Sign In for Pricing
View Details
SOX18 Peptide
DF8018-BP 1 mg

SOX18 Peptide

Sign In for Pricing
View Details