Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD59, Rat (HEK293, His)

The CD59 protein is a potent inhibitor of the complement membrane attack complex (MAC) and exerts regulatory control at or after the C5b-8 stage.Its critical role makes CD59 a key regulator in the complement system, preventing overactivation and associated membrane damage.CD59 Protein, Rat (HEK293, His) is the recombinant rat-derived CD59 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD59 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd59-protein-rat-hek293-his.html

Purity

96.00

Smiles

LRCYNCLDPVSSCKTNSTCSPNLDACLVAVSGKQVYQQCWRFSDCNAKFILSRLEIANVQYRCCQADLCNKSFEDKPN

Molecular Formula

25407 (Gene_ID) P27274 (L23-N100) (Accession)

Molecular Weight

Approximately 14-16 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPIHP2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV741383 1.0 µg DNA

PPIHP2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Hexa sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K4527308 1.0 µg DNA

Hexa sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Lentiviral human ZBTB8A shRNA (UAS) - Lentiviral human ZBTB8A shRNA (UAS, iRFP) (100)
GTR15122931 1 Vial

Lentiviral human ZBTB8A shRNA (UAS) - Lentiviral human ZBTB8A shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Lentiviral human DDX25 sgRNA gene knockout kit - Lentiviral human DDX25 sgRNA gene knockout kit (plasmid)
GTR15395162 1 Vial

Lentiviral human DDX25 sgRNA gene knockout kit - Lentiviral human DDX25 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
Human Cartilage acidic protein 1 (CRTAC1) Elisa Kit
EK712005 96 Well

Human Cartilage acidic protein 1 (CRTAC1) Elisa Kit

Sign In for Pricing
View Details
cry1Ia Antibody
A78351-100UL 100 µL

cry1Ia Antibody

Sign In for Pricing
View Details