Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD59, Rat (HEK293, His)

The CD59 protein is a potent inhibitor of the complement membrane attack complex (MAC) and exerts regulatory control at or after the C5b-8 stage.Its critical role makes CD59 a key regulator in the complement system, preventing overactivation and associated membrane damage.CD59 Protein, Rat (HEK293, His) is the recombinant rat-derived CD59 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD59 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd59-protein-rat-hek293-his.html

Purity

96.00

Smiles

LRCYNCLDPVSSCKTNSTCSPNLDACLVAVSGKQVYQQCWRFSDCNAKFILSRLEIANVQYRCCQADLCNKSFEDKPN

Molecular Formula

25407 (Gene_ID) P27274 (L23-N100) (Accession)

Molecular Weight

Approximately 14-16 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

HTR2C (NM_000868) Human Over-expression Lysate
LY424472 100 µg

HTR2C (NM_000868) Human Over-expression Lysate

Sign In for Pricing
View Details
1700017N19Rik Mouse shRNA Plasmid (Locus ID 66605)
TL517992 1 Kit

1700017N19Rik Mouse shRNA Plasmid (Locus ID 66605)

Sign In for Pricing
View Details
Rabbit Polyclonal SELS Antibody [Alexa Fluor 594]
NBP2-32096AF594 0.1 mL

Rabbit Polyclonal SELS Antibody [Alexa Fluor 594]

Sign In for Pricing
View Details
TUBG1 Protein Vector (Mouse) (pPM-C-His)
PV243037 500 ng

TUBG1 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
CD27/TNFRSF7 Protein, Mouse, Recombinant (His & hFc)
MF-0132947-01 5 µg

CD27/TNFRSF7 Protein, Mouse, Recombinant (His & hFc)

Sign In for Pricing
View Details
CD27/TNFRSF7 Protein, Mouse, Recombinant (His & hFc)
MF-0132947-02 10 µg

CD27/TNFRSF7 Protein, Mouse, Recombinant (His & hFc)

Sign In for Pricing
View Details