Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD59, Rat (HEK293, His)

The CD59 protein is a potent inhibitor of the complement membrane attack complex (MAC) and exerts regulatory control at or after the C5b-8 stage.Its critical role makes CD59 a key regulator in the complement system, preventing overactivation and associated membrane damage.CD59 Protein, Rat (HEK293, His) is the recombinant rat-derived CD59 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD59 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd59-protein-rat-hek293-his.html

Purity

96.00

Smiles

LRCYNCLDPVSSCKTNSTCSPNLDACLVAVSGKQVYQQCWRFSDCNAKFILSRLEIANVQYRCCQADLCNKSFEDKPN

Molecular Formula

25407 (Gene_ID) P27274 (L23-N100) (Accession)

Molecular Weight

Approximately 14-16 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Magic™ Membrane Protein Human DCT (Dopachrome tautomerase) Expressed in vitro E.coli expression system, Full Length of Mature Protein
MPX3941K Each

Magic™ Membrane Protein Human DCT (Dopachrome tautomerase) Expressed in vitro E.coli expression system, Full Length of Mature Protein

Sign In for Pricing
View Details
COL3A1 Monoclonal Antibody
BT-MCA2118-01 50 µL

COL3A1 Monoclonal Antibody

Sign In for Pricing
View Details
COL3A1 Monoclonal Antibody
BT-MCA2118-02 100 µL

COL3A1 Monoclonal Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal Hematopoietic Prostaglandin D Synthase/HPGDS Antibody [Biotin]
NBP2-97023B 0.1 mL

Rabbit Polyclonal Hematopoietic Prostaglandin D Synthase/HPGDS Antibody [Biotin]

Sign In for Pricing
View Details
Mouse Monoclonal Neurotrophin 3 Antibody (OTI5A2) [DyLight 680]
NBP2-72972FR 0.1 mL

Mouse Monoclonal Neurotrophin 3 Antibody (OTI5A2) [DyLight 680]

Sign In for Pricing
View Details
Thioredoxin-1 (Trx-1, trxA, fipA, tsnC, b3781, JW5856) discontinued
T5010-09A 1 mL

Thioredoxin-1 (Trx-1, trxA, fipA, tsnC, b3781, JW5856) discontinued

Sign In for Pricing
View Details