Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD59, Rat (HEK293, His)

The CD59 protein is a potent inhibitor of the complement membrane attack complex (MAC) and exerts regulatory control at or after the C5b-8 stage.Its critical role makes CD59 a key regulator in the complement system, preventing overactivation and associated membrane damage.CD59 Protein, Rat (HEK293, His) is the recombinant rat-derived CD59 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD59 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd59-protein-rat-hek293-his.html

Purity

96.00

Smiles

LRCYNCLDPVSSCKTNSTCSPNLDACLVAVSGKQVYQQCWRFSDCNAKFILSRLEIANVQYRCCQADLCNKSFEDKPN

Molecular Formula

25407 (Gene_ID) P27274 (L23-N100) (Accession)

Molecular Weight

Approximately 14-16 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

HKLK3 (C234) Mouse Monoclonal Antibody
AMM85938-01 1 Each

HKLK3 (C234) Mouse Monoclonal Antibody

Sign In for Pricing
View Details
HKLK3 (C234) Mouse Monoclonal Antibody
AMM85938-02 50 µL

HKLK3 (C234) Mouse Monoclonal Antibody

Sign In for Pricing
View Details
HKLK3 (C234) Mouse Monoclonal Antibody
AMM85938-03 100 µL

HKLK3 (C234) Mouse Monoclonal Antibody

Sign In for Pricing
View Details
PIST, ID (Golgi-associated PDZ and Coiled-coil Motif-containing Protein, PDZ Protein Interacting Specifically with TC10, CFTR-associated Ligand, Fused in Glioblastoma, GOPC, CAL, FIG) (APC) discontinued
P4207-52C-APC 200 µL

PIST, ID (Golgi-associated PDZ and Coiled-coil Motif-containing Protein, PDZ Protein Interacting Specifically with TC10, CFTR-associated Ligand, Fused in Glioblastoma, GOPC, CAL, FIG) (APC) discontinued

Sign In for Pricing
View Details
Human Perforin 1 (PRF1) ELISA Kit
RDR-PRF1-Hu-48Tests 48 Tests

Human Perforin 1 (PRF1) ELISA Kit

Sign In for Pricing
View Details
Histone H4 (Phospho-Ser1) Colorimetric Cell-Based ELISA Kit
MBS9518631-01 1 Kit

Histone H4 (Phospho-Ser1) Colorimetric Cell-Based ELISA Kit

Sign In for Pricing
View Details