CD59, Rat (HEK293, His)
The CD59 protein is a potent inhibitor of the complement membrane attack complex (MAC) and exerts regulatory control at or after the C5b-8 stage.Its critical role makes CD59 a key regulator in the complement system, preventing overactivation and associated membrane damage.CD59 Protein, Rat (HEK293, His) is the recombinant rat-derived CD59 protein, expressed by HEK293 , with C-His labeled tag.
Product Specifications
Product Name Alternative
CD59 Protein, Rat (HEK293, His), Rat, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/cd59-protein-rat-hek293-his.html
Purity
96.00
Smiles
LRCYNCLDPVSSCKTNSTCSPNLDACLVAVSGKQVYQQCWRFSDCNAKFILSRLEIANVQYRCCQADLCNKSFEDKPN
Molecular Formula
25407 (Gene_ID) P27274 (L23-N100) (Accession)
Molecular Weight
Approximately 14-16 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Browse additional items from our catalog
USP16, NT (Ubiquitin Thiolesterase 16, Ubiquitin-specific Processing Protease 16, Deubiquitinating Enzyme 16, Ubiquitin Processing Protease UBP-M, MSTP039) (MaxLight 405)
USP16, NT (Ubiquitin Thiolesterase 16, Ubiquitin-specific Processing Protease 16, Deubiquitinating Enzyme 16, Ubiquitin Processing Protease UBP-M, MSTP039) (MaxLight 405)
MS Certified convenience kit: 2mL clear screw glass vial (9mm short thread) with write-on patch; and bonded blue screw cap (9mm) (PP: clear silicone/clear PTFE septa: 1mm thickness) with AVCS technolo
PPP2R1A (Serine/Threonine-Protein Phosphatase 2A 65kD Regulatory Subunit A alpha Isoform, PP2A Subunit A Isoform PR65-alpha, PP2A Subunit A Isoform R1-alpha, Medium Tumor Antigen-associated 61kD Protein, MGC786) (MaxLight 490)