Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD59, Rat (HEK293, His)

The CD59 protein is a potent inhibitor of the complement membrane attack complex (MAC) and exerts regulatory control at or after the C5b-8 stage.Its critical role makes CD59 a key regulator in the complement system, preventing overactivation and associated membrane damage.CD59 Protein, Rat (HEK293, His) is the recombinant rat-derived CD59 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD59 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd59-protein-rat-hek293-his.html

Purity

96.00

Smiles

LRCYNCLDPVSSCKTNSTCSPNLDACLVAVSGKQVYQQCWRFSDCNAKFILSRLEIANVQYRCCQADLCNKSFEDKPN

Molecular Formula

25407 (Gene_ID) P27274 (L23-N100) (Accession)

Molecular Weight

Approximately 14-16 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal SETD3 Antibody [DyLight 680]
NBP2-32137FR 0.1 mL

Rabbit Polyclonal SETD3 Antibody [DyLight 680]

Sign In for Pricing
View Details
Lentiviral mouse Ackr3 shRNA (UAS) - Lentiviral mouse Ackr3 shRNA (UAS, iRFP) plasmid
GTR15254560 1 Vial

Lentiviral mouse Ackr3 shRNA (UAS) - Lentiviral mouse Ackr3 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
KCTD4 Human Pre-designed siRNA Set A
HY-RS07196 1 Set

KCTD4 Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
FRS3, Human (sf9, GST)
HY-P703007-01 100 µg

FRS3, Human (sf9, GST)

Sign In for Pricing
View Details
FRS3, Human (sf9, GST)
HY-P703007-02 20 µg

FRS3, Human (sf9, GST)

Sign In for Pricing
View Details
C21orf71-set siRNA/shRNA/RNAi Lentivector (Human)
53749091 4x 500 ng

C21orf71-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details