Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD59, Rat (HEK293, His)

The CD59 protein is a potent inhibitor of the complement membrane attack complex (MAC) and exerts regulatory control at or after the C5b-8 stage.Its critical role makes CD59 a key regulator in the complement system, preventing overactivation and associated membrane damage.CD59 Protein, Rat (HEK293, His) is the recombinant rat-derived CD59 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD59 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd59-protein-rat-hek293-his.html

Purity

96.00

Smiles

LRCYNCLDPVSSCKTNSTCSPNLDACLVAVSGKQVYQQCWRFSDCNAKFILSRLEIANVQYRCCQADLCNKSFEDKPN

Molecular Formula

25407 (Gene_ID) P27274 (L23-N100) (Accession)

Molecular Weight

Approximately 14-16 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCNA Mouse Monoclonal Antibody [Clone ID: OTI1A5]
TA804965 100 µL

PCNA Mouse Monoclonal Antibody [Clone ID: OTI1A5]

Sign In for Pricing
View Details
EPO
ant-196 0.5mg

EPO

Sign In for Pricing
View Details
Lentiviral human ZGPAT shRNA (UAS) - Lentiviral human ZGPAT shRNA (UAS, GFP) plasmid
GTR15337369 1 Vial

Lentiviral human ZGPAT shRNA (UAS) - Lentiviral human ZGPAT shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
CXCL5 Recombinant Antibody
bsm-62331R-01 20 µL

CXCL5 Recombinant Antibody

Sign In for Pricing
View Details
CXCL5 Recombinant Antibody
bsm-62331R-02 100 µL

CXCL5 Recombinant Antibody

Sign In for Pricing
View Details
GAL6 (Galectin 6) BioAssayTM ELISA Kit (Mouse) discontinued
355844-01 48 Tests

GAL6 (Galectin 6) BioAssayTM ELISA Kit (Mouse) discontinued

Sign In for Pricing
View Details