Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD59, Rat (HEK293, His)

The CD59 protein is a potent inhibitor of the complement membrane attack complex (MAC) and exerts regulatory control at or after the C5b-8 stage.Its critical role makes CD59 a key regulator in the complement system, preventing overactivation and associated membrane damage.CD59 Protein, Rat (HEK293, His) is the recombinant rat-derived CD59 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD59 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd59-protein-rat-hek293-his.html

Purity

96.00

Smiles

LRCYNCLDPVSSCKTNSTCSPNLDACLVAVSGKQVYQQCWRFSDCNAKFILSRLEIANVQYRCCQADLCNKSFEDKPN

Molecular Formula

25407 (Gene_ID) P27274 (L23-N100) (Accession)

Molecular Weight

Approximately 14-16 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NETO1 (NM_138966) Human Tagged Lenti ORF Clone
RC208002L4 10 µg

NETO1 (NM_138966) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Rabbit Monoclonal MYO19 Antibody (SR4212)
NBP3-27822-100ul 100 µL

Rabbit Monoclonal MYO19 Antibody (SR4212)

Sign In for Pricing
View Details
Rabbit Polyclonal Musashi-2 Antibody [mFluor Violet 610 SE]
NBP1-76575MFV610 0.1 mL

Rabbit Polyclonal Musashi-2 Antibody [mFluor Violet 610 SE]

Sign In for Pricing
View Details
Apobec1 (NM_012907) Rat Tagged ORF Clone
RR201536 10 µg

Apobec1 (NM_012907) Rat Tagged ORF Clone

Sign In for Pricing
View Details
Eco AluRack 17 boxes, 40mm, 725x140x140mm
TE11448 1 Piece

Eco AluRack 17 boxes, 40mm, 725x140x140mm

Sign In for Pricing
View Details
200μL Low Adsorption Filter Pipette Tips, Sterile, DNase and RNase Free, Endotoxin Free, 96pcs*50racks/Carton
21081503 4800 PCS

200μL Low Adsorption Filter Pipette Tips, Sterile, DNase and RNase Free, Endotoxin Free, 96pcs*50racks/Carton

Sign In for Pricing
View Details