Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD59, Rat (HEK293, His)

The CD59 protein is a potent inhibitor of the complement membrane attack complex (MAC) and exerts regulatory control at or after the C5b-8 stage.Its critical role makes CD59 a key regulator in the complement system, preventing overactivation and associated membrane damage.CD59 Protein, Rat (HEK293, His) is the recombinant rat-derived CD59 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD59 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd59-protein-rat-hek293-his.html

Purity

96.00

Smiles

LRCYNCLDPVSSCKTNSTCSPNLDACLVAVSGKQVYQQCWRFSDCNAKFILSRLEIANVQYRCCQADLCNKSFEDKPN

Molecular Formula

25407 (Gene_ID) P27274 (L23-N100) (Accession)

Molecular Weight

Approximately 14-16 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Plant H-Ras (H-RAS) ELISA Kit
MBS9373726 Inquire

Plant H-Ras (H-RAS) ELISA Kit

Sign In for Pricing
View Details
MSI1 Antibody, Biotin conjugated
A28984-100UG 100 µg

MSI1 Antibody, Biotin conjugated

Sign In for Pricing
View Details
Anti-interferon alpha 5/IFNA5 Antibody (4J899)
MF-0160641 100 µL

Anti-interferon alpha 5/IFNA5 Antibody (4J899)

Sign In for Pricing
View Details
Ifi27 sgRNA CRISPR Lentivector (Rat) (Target 3)
K7616404 1.0 µg DNA

Ifi27 sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Biotin-PEG-Mal, 5K
HE041022-5K 1 g

Biotin-PEG-Mal, 5K

Sign In for Pricing
View Details
Rat NAGase (N-Acetyl Beta-D-Glucosaminidase) ValidElisa Kit
EK342365 96 Well

Rat NAGase (N-Acetyl Beta-D-Glucosaminidase) ValidElisa Kit

Sign In for Pricing
View Details