Virus M protein
This Virus M protein spans the amino acid sequence from region 1-237aa. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
M, Matrix protein
UniProt
P04876
Expression Region
1-237aa
Tag
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Source
Baculovirus
Origin
Vesicular stomatitis Indiana virus (strain Glasgow) (VSIV)
Field of Research
Infectious Disease & Virology
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
30.7 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Full Length
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
MSSLKKILGLKGKGKKSKKLGIAPPPYEEDTSMEYAPSAPIDKSYFGVDEMDTHDPNQLRYEKSFFTVKMTVRSNRPFRTYSDVAAAVSHWDHMYIGMAGKRPFYKILAFLGSSNLKATPAVLADQGQPEYHAHCEGRAYLPHRMGKTPPMLNVPEHFRRPFNIGLYKGTIELTMTIYDDESLEAAPMIWDHFNSSKFSDFREKALMFGLIVEEEASGAWVLDSVRHSKWASLASSF
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
PB9252-Biotin 100 µg/Vial
Anti-Fas Antibody Picoband® (Biotine Conjugate)
Sign In for Pricing
View Details 
GTR15272227 1 Vial
Lentiviral mouse Csf2ra shRNA (UAS) - Lentiviral mouse Csf2ra shRNA (UAS) plasmid
Sign In for Pricing
View Details 
E3384-75H-HRP 200 µL
EPM2A, CT (Laforin, Lafora PTPase, LAFPTPase) (Azide free) (HRP) discontinued
Sign In for Pricing
View Details 247413 50 µL
IFNA1 (Interferon, alpha 1, IFL, IFN, IFN-ALPHA, IFNA13, IFNA@, MGC138207, MGC138505, MGC138507)
Sign In for Pricing
View Details