Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Virus M protein

This Virus M protein spans the amino acid sequence from region 1-237aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

M, Matrix protein

UniProt

P04876

Expression Region

1-237aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Origin

Vesicular stomatitis Indiana virus (strain Glasgow) (VSIV)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSSLKKILGLKGKGKKSKKLGIAPPPYEEDTSMEYAPSAPIDKSYFGVDEMDTHDPNQLRYEKSFFTVKMTVRSNRPFRTYSDVAAAVSHWDHMYIGMAGKRPFYKILAFLGSSNLKATPAVLADQGQPEYHAHCEGRAYLPHRMGKTPPMLNVPEHFRRPFNIGLYKGTIELTMTIYDDESLEAAPMIWDHFNSSKFSDFREKALMFGLIVEEEASGAWVLDSVRHSKWASLASSF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TCFL5 siRNA (Human)
orb1860947-01 15 nmol

TCFL5 siRNA (Human)

Sign In for Pricing
View Details
TCFL5 siRNA (Human)
orb1860947-02 30 nmol

TCFL5 siRNA (Human)

Sign In for Pricing
View Details
HSF2BP Protein Vector (Rat) (pPB-C-His)
PV273602 500 ng

HSF2BP Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
Lentiviral mouse Trmt2b shRNA (UAS) - Lentiviral mouse Trmt2b shRNA (UAS, iRFP) (100)
GTR15216315 1 Vial

Lentiviral mouse Trmt2b shRNA (UAS) - Lentiviral mouse Trmt2b shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
CRABP2 Conjugated Antibody
orb1621660 100 µL

CRABP2 Conjugated Antibody

Sign In for Pricing
View Details
Gel Scoop
5013700/A 1 Each

Gel Scoop

Sign In for Pricing
View Details