Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Virus M protein

This Virus M protein spans the amino acid sequence from region 1-237aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

M, Matrix protein

UniProt

P04876

Expression Region

1-237aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Origin

Vesicular stomatitis Indiana virus (strain Glasgow) (VSIV)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSSLKKILGLKGKGKKSKKLGIAPPPYEEDTSMEYAPSAPIDKSYFGVDEMDTHDPNQLRYEKSFFTVKMTVRSNRPFRTYSDVAAAVSHWDHMYIGMAGKRPFYKILAFLGSSNLKATPAVLADQGQPEYHAHCEGRAYLPHRMGKTPPMLNVPEHFRRPFNIGLYKGTIELTMTIYDDESLEAAPMIWDHFNSSKFSDFREKALMFGLIVEEEASGAWVLDSVRHSKWASLASSF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human OX (Orexin) ELISA Kit
EH24993 96 Tests

Human OX (Orexin) ELISA Kit

Sign In for Pricing
View Details
Anti-HLA-C Antibody Picoband® (Biotine Conjugate)
PB9377-Biotin 100 µg/Vial

Anti-HLA-C Antibody Picoband® (Biotine Conjugate)

Sign In for Pricing
View Details
MSH3 Rabbit Polyclonal Antibody (Cy3)
orb980598 100 µL

MSH3 Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
ATF6 Rabbit Polyclonal Antibody (BF555)
orb1607502 100 µL

ATF6 Rabbit Polyclonal Antibody (BF555)

Sign In for Pricing
View Details
Lentiviral human RNF175 sgRNA gene knockout kit - Lentiviral human RNF175 sgRNA gene knockout kit (100)
GTR15355233 1 Vial

Lentiviral human RNF175 sgRNA gene knockout kit - Lentiviral human RNF175 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
KRT15 Protein Vector (Rat) (pPB-C-His)
PV276762 500 ng

KRT15 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details