Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Virus M protein

This Virus M protein spans the amino acid sequence from region 1-237aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

M, Matrix protein

UniProt

P04876

Expression Region

1-237aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Origin

Vesicular stomatitis Indiana virus (strain Glasgow) (VSIV)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSSLKKILGLKGKGKKSKKLGIAPPPYEEDTSMEYAPSAPIDKSYFGVDEMDTHDPNQLRYEKSFFTVKMTVRSNRPFRTYSDVAAAVSHWDHMYIGMAGKRPFYKILAFLGSSNLKATPAVLADQGQPEYHAHCEGRAYLPHRMGKTPPMLNVPEHFRRPFNIGLYKGTIELTMTIYDDESLEAAPMIWDHFNSSKFSDFREKALMFGLIVEEEASGAWVLDSVRHSKWASLASSF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Pyruvate Kinase, Liver And RBC/PKLR Protein (C-6His)
ARP5464-01 10 µg

Recombinant Human Pyruvate Kinase, Liver And RBC/PKLR Protein (C-6His)

Sign In for Pricing
View Details
Recombinant Human Pyruvate Kinase, Liver And RBC/PKLR Protein (C-6His)
ARP5464-02 50 µg

Recombinant Human Pyruvate Kinase, Liver And RBC/PKLR Protein (C-6His)

Sign In for Pricing
View Details
Recombinant Human Pyruvate Kinase, Liver And RBC/PKLR Protein (C-6His)
ARP5464-03 100 µg

Recombinant Human Pyruvate Kinase, Liver And RBC/PKLR Protein (C-6His)

Sign In for Pricing
View Details
Recombinant Human Pyruvate Kinase, Liver And RBC/PKLR Protein (C-6His)
ARP5464-04 1 mg

Recombinant Human Pyruvate Kinase, Liver And RBC/PKLR Protein (C-6His)

Sign In for Pricing
View Details
Recombinant Anaeromyxobacter sp. Peptidyl-tRNA hydrolase (pth)
MBS1255523-01 0.02 mg (E-Coli)

Recombinant Anaeromyxobacter sp. Peptidyl-tRNA hydrolase (pth)

Sign In for Pricing
View Details
Recombinant Anaeromyxobacter sp. Peptidyl-tRNA hydrolase (pth)
MBS1255523-02 0.1 mg (E-Coli)

Recombinant Anaeromyxobacter sp. Peptidyl-tRNA hydrolase (pth)

Sign In for Pricing
View Details