Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacteria acpS protein

This Bacteria acpS protein spans the amino acid sequence from region 1-118aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

4'-phosphopantetheinyl transferase AcpS (Holo-ACP synthase)

UniProt

Q48RM7

Expression Region

1-118aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Origin

Streptococcus pyogenes serotype M28 (strain MGAS6180)

Field of Research

Non-Animal

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MIVGHGIDLQEISAIEKVYQRNPRFAQKILTEQELAIFESFPYKRRLSYLAGRWAGKEAFAKAIGTGIGRLTFQDIEILNDVRGCPILTKSPFKGNSFISISHSGNYVQASVILEDKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Fruit fly cheerio/Filamin Antibody, Cy3 Conjugate
DZ00502-Cy3 200 µL/Vial

Anti-Fruit fly cheerio/Filamin Antibody, Cy3 Conjugate

Sign In for Pricing
View Details
GGA3 (NM_014001) Human Tagged ORF Clone Lentiviral Particle
RC209737L4V 200 µL

GGA3 (NM_014001) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
5′ ATTO-Rho14 / 3′ BHQ-2® (10 to 19 nmol)
JBS-FP-199-10 10 nmol

5′ ATTO-Rho14 / 3′ BHQ-2® (10 to 19 nmol)

Sign In for Pricing
View Details
Rabenosyn 5 Rabbit Polyclonal Antibody (BF750)
orb2466431 100 µL

Rabenosyn 5 Rabbit Polyclonal Antibody (BF750)

Sign In for Pricing
View Details
Carnostatine hydrochloride
orb1710152-01 25 mg

Carnostatine hydrochloride

Sign In for Pricing
View Details
Carnostatine hydrochloride
orb1710152-02 50 mg

Carnostatine hydrochloride

Sign In for Pricing
View Details