Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CD274 protein

This Human CD274 protein spans the amino acid sequence from region 19-238aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PD-L1 (PDCD1 ligand 1) (Programmed death ligand 1) (hPD-L1) (B7 homolog 1) (B7-H1) (CD274)

UniProt

Q9NZQ7

Expression Region

19-238aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized PD-L1 at 2 μg/ml can bind Anti- PD-L1 mouse monoclonal antibody (antigen from E.coli), the EC50 of human PD-L1 protein is 1.252-1.653 ng/mL.

Form

Lyophilized powder

Molecular Weight

52.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Extracellular Domain

Preservative

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

AA Sequence

FTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNER

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Erwinia tasmaniensis Nicotinate phosphoribosyltransferase (pncB)
MBS1091597-01 0.02 mg (E-Coli)

Recombinant Erwinia tasmaniensis Nicotinate phosphoribosyltransferase (pncB)

Sign In for Pricing
View Details
Recombinant Erwinia tasmaniensis Nicotinate phosphoribosyltransferase (pncB)
MBS1091597-02 0.02 mg (Yeast)

Recombinant Erwinia tasmaniensis Nicotinate phosphoribosyltransferase (pncB)

Sign In for Pricing
View Details
Recombinant Erwinia tasmaniensis Nicotinate phosphoribosyltransferase (pncB)
MBS1091597-03 0.1 mg (E-Coli)

Recombinant Erwinia tasmaniensis Nicotinate phosphoribosyltransferase (pncB)

Sign In for Pricing
View Details
Recombinant Erwinia tasmaniensis Nicotinate phosphoribosyltransferase (pncB)
MBS1091597-04 0.1 mg (Yeast)

Recombinant Erwinia tasmaniensis Nicotinate phosphoribosyltransferase (pncB)

Sign In for Pricing
View Details
Recombinant Erwinia tasmaniensis Nicotinate phosphoribosyltransferase (pncB)
MBS1091597-05 0.02 mg (Baculovirus)

Recombinant Erwinia tasmaniensis Nicotinate phosphoribosyltransferase (pncB)

Sign In for Pricing
View Details
Recombinant Erwinia tasmaniensis Nicotinate phosphoribosyltransferase (pncB)
MBS1091597-06 0.02 mg (Mammalian-Cell)

Recombinant Erwinia tasmaniensis Nicotinate phosphoribosyltransferase (pncB)

Sign In for Pricing
View Details