Human CD274 protein
This Human CD274 protein spans the amino acid sequence from region 19-238aa. Purity: Greater than 95% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
PD-L1 (PDCD1 ligand 1) (Programmed death ligand 1) (hPD-L1) (B7 homolog 1) (B7-H1) (CD274)
UniProt
Q9NZQ7
Expression Region
19-238aa
Tag
C-terminal hFc1-tagged
Source
Mammalian cell
Origin
Homo sapiens (Human)
Field of Research
Immunology & Inflammation
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Purity
Greater than 95% as determined by SDS-PAGE.
Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized PD-L1 at 2 μg/ml can bind Anti- PD-L1 mouse monoclonal antibody (antigen from E.coli), the EC50 of human PD-L1 protein is 1.252-1.653 ng/mL.
Form
Lyophilized powder
Molecular Weight
52.7 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Extracellular Domain
Preservative
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
AA Sequence
FTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNER
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS2118546-01 0.1 mL
PE-Linked Polyclonal Antibody to Neurokinin B (NKB)
Sign In for Pricing
View Details MBS2118546-02 0.2 mL
PE-Linked Polyclonal Antibody to Neurokinin B (NKB)
Sign In for Pricing
View Details MBS2118546-03 0.5 mL
PE-Linked Polyclonal Antibody to Neurokinin B (NKB)
Sign In for Pricing
View Details MBS2118546-04 1 mL
PE-Linked Polyclonal Antibody to Neurokinin B (NKB)
Sign In for Pricing
View Details MBS2118546-05 5 mL
PE-Linked Polyclonal Antibody to Neurokinin B (NKB)
Sign In for Pricing
View Details