Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ACTL8 protein

This Human ACTL8 protein spans the amino acid sequence from region 1-366aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cancer/testis antigen 57 (CT57)

UniProt

Q9H568

Expression Region

1-366aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

45.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAARTVIIDHGSGFLKAGTAGWNEPQMVFPNIVNYLPCKENPGPSYARRRVSLGIDICHPDTFSYPIERGRILNWEGVQYLWSFVLENHRREQEVPPVIITETPLREPADRKKMLEILFELLHVPSVLLADQLQMSLYASGLLTGVVVDSGYGLTRVQPFHQGRPLPASGKTLEFAGQDLSAYLLKSLFKEDCDRRCLFQLETVAVTQMNKCYVPQNLGEALDFRERQQSALDESNTYQLPDGSRVELTPMQRVAPEMFFSPQVFEQPGPSIPRAIVESVESCEISLRPLLVSHVMACGGNTLYPGFTKRLFRELMGDHVSSTKATVWEGSNRNFSVWLGASVVAHLSTYQSEWMSREEYGEHMRM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OSBPL3 Rabbit Polyclonal Antibody (Biotin)
orb2117806 100 µL

OSBPL3 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
ARF5 Antibody
orb242145-01 50 µg

ARF5 Antibody

Sign In for Pricing
View Details
ARF5 Antibody
orb242145-02 100 µg

ARF5 Antibody

Sign In for Pricing
View Details
2- (((3,4-Dimethylheptyl) oxy) carbonyl) benzoic Acid (Phthalate Monoester)
159114 10 mg

2- (((3,4-Dimethylheptyl) oxy) carbonyl) benzoic Acid (Phthalate Monoester)

Sign In for Pricing
View Details
Recombinant Mouse Chromogranin-A/Chga protein (His Tag)
MBS2571059-01 0.02 mg

Recombinant Mouse Chromogranin-A/Chga protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse Chromogranin-A/Chga protein (His Tag)
MBS2571059-02 0.1 mg

Recombinant Mouse Chromogranin-A/Chga protein (His Tag)

Sign In for Pricing
View Details