Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human HLA-E protein

This Human HLA-E protein spans the amino acid sequence from region 22-305aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MHC class I antigen E (HLA-6.2) (HLAE)

UniProt

P13747

Expression Region

22-305aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Extracellular Domain

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GSHSLKYFHTSVSRPGRGEPRFISVGYVDDTQFVRFDNDAASPRMVPRAPWMEQEGSEYWDRETRSARDTAQIFRVNLRTLRGYYNQSEAGSHTLQWMHGCELGPDRRFLRGYEQFAYDGKDYLTLNEDLRSWTAVDTAAQISEQKSNDASEAEHQRAYLEDTCVEWLHKYLEKGKETLLHLEPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQQDGEGHTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPVTLRWKPASQPTIPI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Histone H4
547562 200 µL

Histone H4

Sign In for Pricing
View Details
GM130 Rabbit pAb
MBS8542242-01 0.1 mL

GM130 Rabbit pAb

Sign In for Pricing
View Details
GM130 Rabbit pAb
MBS8542242-02 0.1 mL (AF405L)

GM130 Rabbit pAb

Sign In for Pricing
View Details
GM130 Rabbit pAb
MBS8542242-03 0.1 mL (AF405S)

GM130 Rabbit pAb

Sign In for Pricing
View Details
GM130 Rabbit pAb
MBS8542242-04 0.1 mL (AF610)

GM130 Rabbit pAb

Sign In for Pricing
View Details
GM130 Rabbit pAb
MBS8542242-05 0.1 mL (AF635)

GM130 Rabbit pAb

Sign In for Pricing
View Details