Virus G protein
This Virus G protein spans the amino acid sequence from region 67-298aa. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Attachment glycoprotein GMembrane-bound glycoprotein (mG)
UniProt
P03423
Expression Region
67-298aa
Tag
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Source
Baculovirus
Origin
Human respiratory syncytial virus A (strain A2)
Field of Research
Infectious Disease & Virology
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
29.3 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Partial
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
HKVTPTTAIIQDATSQIKNTTPTYLTQNPQLGISPSNPSEITSQITTILASTTPGVKSTLQSTTVKTKNTTTTQTQPSKPTTKQRQNKPPSKPNNDFHFEVFNFVPCSICSNNPTCWAICKRIPNKKPGKKTTTKPTKKPTLKTTKKDPKPQTTKSKEVPTTKPTEEPTINTTKTNIITTLLTSNTTGNPELTSQMETFHSTSSEGNPSPSQVSTTSEYPSQPSSPPNTPRQ
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS2118619-01 0.1 mL
PE-Linked Monoclonal Antibody to Interleukin 10 Receptor Alpha (IL10Ra)
Sign In for Pricing
View Details MBS2118619-02 0.2 mL
PE-Linked Monoclonal Antibody to Interleukin 10 Receptor Alpha (IL10Ra)
Sign In for Pricing
View Details MBS2118619-03 0.5 mL
PE-Linked Monoclonal Antibody to Interleukin 10 Receptor Alpha (IL10Ra)
Sign In for Pricing
View Details MBS2118619-04 1 mL
PE-Linked Monoclonal Antibody to Interleukin 10 Receptor Alpha (IL10Ra)
Sign In for Pricing
View Details MBS2118619-05 5 mL
PE-Linked Monoclonal Antibody to Interleukin 10 Receptor Alpha (IL10Ra)
Sign In for Pricing
View Details