Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Virus G protein

This Virus G protein spans the amino acid sequence from region 67-298aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Attachment glycoprotein GMembrane-bound glycoprotein (mG)

UniProt

P03423

Expression Region

67-298aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Origin

Human respiratory syncytial virus A (strain A2)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

HKVTPTTAIIQDATSQIKNTTPTYLTQNPQLGISPSNPSEITSQITTILASTTPGVKSTLQSTTVKTKNTTTTQTQPSKPTTKQRQNKPPSKPNNDFHFEVFNFVPCSICSNNPTCWAICKRIPNKKPGKKTTTKPTKKPTLKTTKKDPKPQTTKSKEVPTTKPTEEPTINTTKTNIITTLLTSNTTGNPELTSQMETFHSTSSEGNPSPSQVSTTSEYPSQPSSPPNTPRQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MPZL2 (Biotin)
568996-01 50 µg

MPZL2 (Biotin)

Sign In for Pricing
View Details
MPZL2 (Biotin)
568996-02 100 µg

MPZL2 (Biotin)

Sign In for Pricing
View Details
Human Phospho Tyrosine-Protein Kinase ABL1 (PABL1-Y245) ELISA Kit
MBS9935537-01 48 Well

Human Phospho Tyrosine-Protein Kinase ABL1 (PABL1-Y245) ELISA Kit

Sign In for Pricing
View Details
Human Phospho Tyrosine-Protein Kinase ABL1 (PABL1-Y245) ELISA Kit
MBS9935537-02 96 Well

Human Phospho Tyrosine-Protein Kinase ABL1 (PABL1-Y245) ELISA Kit

Sign In for Pricing
View Details
Human Phospho Tyrosine-Protein Kinase ABL1 (PABL1-Y245) ELISA Kit
MBS9935537-03 5x 96 Well

Human Phospho Tyrosine-Protein Kinase ABL1 (PABL1-Y245) ELISA Kit

Sign In for Pricing
View Details
Human Phospho Tyrosine-Protein Kinase ABL1 (PABL1-Y245) ELISA Kit
MBS9935537-04 10x 96 Well

Human Phospho Tyrosine-Protein Kinase ABL1 (PABL1-Y245) ELISA Kit

Sign In for Pricing
View Details