Rat Apoc1 protein
This Rat Apoc1 protein spans the amino acid sequence from region 27-88aa. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Apolipoprotein C1 (Liver regeneration-related protein LRRG04)
UniProt
P19939
Expression Region
27-88aa
Tag
C-terminal hFc1-tagged
Source
Mammalian cell
Origin
Rattus norvegicus (Rat)
Field of Research
Cardiovascular Research
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
34.7 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Full Length of Mature Protein
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
APDFSSAMESLPDKLKEFGNTLEDKARAAIEHIKQKEIMIKTRNWFSETLNKMKEKLKTTFA
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
orb480481 100 µL
Nucleoprotein TPR Rabbit Polyclonal Antibody (HRP)
Sign In for Pricing
View Details MBS4501591-01 48 Tests
Human Osteoclast Associated Receptor (OSCAR) ELISA Kit
Sign In for Pricing
View Details MBS4501591-02 96 Tests
Human Osteoclast Associated Receptor (OSCAR) ELISA Kit
Sign In for Pricing
View Details MBS4501591-03 5x 96 Tests
Human Osteoclast Associated Receptor (OSCAR) ELISA Kit
Sign In for Pricing
View Details