Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Apoc1 protein

This Rat Apoc1 protein spans the amino acid sequence from region 27-88aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Apolipoprotein C1 (Liver regeneration-related protein LRRG04)

UniProt

P19939

Expression Region

27-88aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Rattus norvegicus (Rat)

Field of Research

Cardiovascular Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

APDFSSAMESLPDKLKEFGNTLEDKARAAIEHIKQKEIMIKTRNWFSETLNKMKEKLKTTFA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frizzled-5 (FZD5) Rat ELISA Kit
D5171 96 Tests

Frizzled-5 (FZD5) Rat ELISA Kit

Sign In for Pricing
View Details
CDK2 (Cell Division Protein Kinase 2, p33 Protein Kinase) (MaxLight 550)
MBS6210724-01 0.1 mL

CDK2 (Cell Division Protein Kinase 2, p33 Protein Kinase) (MaxLight 550)

Sign In for Pricing
View Details
CDK2 (Cell Division Protein Kinase 2, p33 Protein Kinase) (MaxLight 550)
MBS6210724-02 5x 0.1 mL

CDK2 (Cell Division Protein Kinase 2, p33 Protein Kinase) (MaxLight 550)

Sign In for Pricing
View Details
Phospho-NFKBIA (Ser32)) Antibody
MBS9205657-01 0.08 mL

Phospho-NFKBIA (Ser32)) Antibody

Sign In for Pricing
View Details
Phospho-NFKBIA (Ser32)) Antibody
MBS9205657-02 0.4 mL

Phospho-NFKBIA (Ser32)) Antibody

Sign In for Pricing
View Details
Phospho-NFKBIA (Ser32)) Antibody
MBS9205657-03 5x 0.4 mL

Phospho-NFKBIA (Ser32)) Antibody

Sign In for Pricing
View Details