Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Primate TMEM168 protein

This Primate TMEM168 protein spans the amino acid sequence from region 527-637aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

TMEM168, Transmembrane protein 168

UniProt

Q5RD28

Expression Region

527-637aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Origin

Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)

Field of Research

Epigenetics

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EWWREKNGSFCSRLIIVLDSENSTPWVKEVRKINDQYIAVQGAELIKTVDIEEADPPQLGDFTKDWVEYNCNSSNNICWTEKGRTVKAVYGVSKRWSDYTLHLPTGSDVAK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UBE2E3 polyclonal antibody
BS77845-01 50 µL

UBE2E3 polyclonal antibody

Sign In for Pricing
View Details
UBE2E3 polyclonal antibody
BS77845-02 100 µL

UBE2E3 polyclonal antibody

Sign In for Pricing
View Details
Rat C-type natriuretic peptide (CNP) ELISA Kit
AE58191RA-01 48 Tests

Rat C-type natriuretic peptide (CNP) ELISA Kit

Sign In for Pricing
View Details
Rat C-type natriuretic peptide (CNP) ELISA Kit
AE58191RA-02 96 Tests

Rat C-type natriuretic peptide (CNP) ELISA Kit

Sign In for Pricing
View Details
KLHL26 siRNA (Mouse)
CRN3152-01 15 nmol

KLHL26 siRNA (Mouse)

Sign In for Pricing
View Details
KLHL26 siRNA (Mouse)
CRN3152-02 30 nmol

KLHL26 siRNA (Mouse)

Sign In for Pricing
View Details