Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Primate TMEM168 protein

This Primate TMEM168 protein spans the amino acid sequence from region 527-637aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

TMEM168, Transmembrane protein 168

UniProt

Q5RD28

Expression Region

527-637aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Origin

Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)

Field of Research

Epigenetics

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EWWREKNGSFCSRLIIVLDSENSTPWVKEVRKINDQYIAVQGAELIKTVDIEEADPPQLGDFTKDWVEYNCNSSNNICWTEKGRTVKAVYGVSKRWSDYTLHLPTGSDVAK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Lce1b shRNA (UAS) - Lentiviral mouse Lce1b shRNA (UAS, iRFP) plasmid
GTR15285100 1 Vial

Lentiviral mouse Lce1b shRNA (UAS) - Lentiviral mouse Lce1b shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
UGP2 (UTP--glucose-1-phosphate Uridylyltransferase, UDP-glucose Pyrophosphorylase, UDPGP, UGPase, UGP1) (MaxLight 650)
135066-ML650 100 µL

UGP2 (UTP--glucose-1-phosphate Uridylyltransferase, UDP-glucose Pyrophosphorylase, UDPGP, UGPase, UGP1) (MaxLight 650)

Sign In for Pricing
View Details
SOX30, ID (SOX30, Transcription factor SOX-30) (AP) discontinued
042171-AP 200 µL

SOX30, ID (SOX30, Transcription factor SOX-30) (AP) discontinued

Sign In for Pricing
View Details
Anti-Mouse NKG2D Antibody (MI-6), APC
FMD72113 100 Tests

Anti-Mouse NKG2D Antibody (MI-6), APC

Sign In for Pricing
View Details
BCAM siRNA (Rat)
MBS8230268-01 15 nmol

BCAM siRNA (Rat)

Sign In for Pricing
View Details
BCAM siRNA (Rat)
MBS8230268-02 30 nmol

BCAM siRNA (Rat)

Sign In for Pricing
View Details