Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Hadha protein

This Mouse Hadha protein spans the amino acid sequence from region 348-763aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

TP-alpha

UniProt

Q8BMS1

Expression Region

348-763aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

50.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LCKKNKFGAPQKNVQQLAILGAGLMGAGIAQVSVDKGLKTLLKDTTVTGLGRGQQQVFKGLNDKVKKKALTSFERDSIFSNLIGQLDYKGFEKADMVIEAVFEDLGVKHKVLKEVESVTPEHCIFASNTSALPINQIAAVSKRPEKVIGMHYFSPVDKMQLLEIITTDKTSKDTTASAVAVGLRQGKVIIVVKDGPGFYTTRCLAPMMSEVMRILQEGVDPKKLDALTTGFGFPVGAATLADEVGVDVAQHVAEDLGKAFGERFGGGSVELLKQMVSKGFLGRKSGKGFYIYQEGSKNKSLNSEMDNILANLRLPAKPEVSSDEDVQYRVITRFVNEAVLCLQEGILATPAEGDIGAVFGLGFPPCLGGPFRFVDLYGAQKVVDRLRKYESAYGTQFTPCQLLLDHANNSSKKFYQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PNLIPRP2 (Pancreatic Lipase-Related Protein 2, PLRP2)
250259 50 µL

PNLIPRP2 (Pancreatic Lipase-Related Protein 2, PLRP2)

Sign In for Pricing
View Details
C21orf62 Antibody - middle region : FITC (ARP45868_P050-FITC)
ARP45868_P050-FITC 100 µL

C21orf62 Antibody - middle region : FITC (ARP45868_P050-FITC)

Sign In for Pricing
View Details
Anti-human CCR-4 Monoclonal
orb1129185 100 µg

Anti-human CCR-4 Monoclonal

Sign In for Pricing
View Details
Trans-4-Aminocyclohexanol Hydrochloride
002106 1 g

Trans-4-Aminocyclohexanol Hydrochloride

Sign In for Pricing
View Details
NAP1L1 (15I8) Rabbit Monoclonal Antibody
E28M6291 100 µL

NAP1L1 (15I8) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
2-Hydroxy Fluorene
TRC-H942430-50MG 50 mg

2-Hydroxy Fluorene

Sign In for Pricing
View Details