Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Hadha protein

This Mouse Hadha protein spans the amino acid sequence from region 348-763aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

TP-alpha

UniProt

Q8BMS1

Expression Region

348-763aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

50.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LCKKNKFGAPQKNVQQLAILGAGLMGAGIAQVSVDKGLKTLLKDTTVTGLGRGQQQVFKGLNDKVKKKALTSFERDSIFSNLIGQLDYKGFEKADMVIEAVFEDLGVKHKVLKEVESVTPEHCIFASNTSALPINQIAAVSKRPEKVIGMHYFSPVDKMQLLEIITTDKTSKDTTASAVAVGLRQGKVIIVVKDGPGFYTTRCLAPMMSEVMRILQEGVDPKKLDALTTGFGFPVGAATLADEVGVDVAQHVAEDLGKAFGERFGGGSVELLKQMVSKGFLGRKSGKGFYIYQEGSKNKSLNSEMDNILANLRLPAKPEVSSDEDVQYRVITRFVNEAVLCLQEGILATPAEGDIGAVFGLGFPPCLGGPFRFVDLYGAQKVVDRLRKYESAYGTQFTPCQLLLDHANNSSKKFYQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL37P14 sgRNA CRISPR Lentivector set (Human)
K1988101 3x 1.0 µg

RPL37P14 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Rabbit Monoclonal Midkine Antibody (2284A) [Janelia Fluor 549]
FAB2581I 0.1 mL

Rabbit Monoclonal Midkine Antibody (2284A) [Janelia Fluor 549]

Sign In for Pricing
View Details
Cpa3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K6832706 1.0 µg DNA

Cpa3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
LASS2 Adenovirus (Human)
26320051 1.0 mL

LASS2 Adenovirus (Human)

Sign In for Pricing
View Details
Rno-miR-370-5p agomir
HY-R04445A-01 5 nmol

Rno-miR-370-5p agomir

Sign In for Pricing
View Details
Rno-miR-370-5p agomir
HY-R04445A-02 20 nmol

Rno-miR-370-5p agomir

Sign In for Pricing
View Details