Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human BPHL protein

This Human BPHL protein spans the amino acid sequence from region 38-291aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Biphenyl hydrolase-like protein (Biphenyl hydrolase-related protein) (Bph-rp) (Breast epithelial mucin-associated antigen) (MCNAA)

UniProt

Q86WA6

Expression Region

38-291aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SVTSAKVAVNGVQLHYQQTGEGDHAVLLLPGMLGSGETDFGPQLKNLNKKLFTVVAWDPRGYGHSRPPDRDFPADFFERDAKDAVDLMKALKFKKVSLLGWSDGGITALIAAAKYPSYIHKMVIWGANAYVTDEDSMIYEGIRDVSKWSERTRKPLEALYGYDYFARTCEKWVDGIRQFKHLPDGNICRHLLPRVQCPALIVHGEKDPLVPRFHADFIHKHVKGSRLHLMPEGKHNLHLRFADEFNKLAEDFLQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-IER5 Antibody, Rabbit Polyclonal
MBS8108678-01 0.1 mL

Anti-IER5 Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Anti-IER5 Antibody, Rabbit Polyclonal
MBS8108678-02 5x 0.1 mL

Anti-IER5 Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Mouse anti-Human CD34 Monoclonal Antibody, Biotin
E16HB0341-100 100 Tests

Mouse anti-Human CD34 Monoclonal Antibody, Biotin

Sign In for Pricing
View Details
Lentiviral mouse Hsd3b4 shRNA (UAS) - Lentiviral mouse Hsd3b4 shRNA (UAS, iRFP) plasmid
GTR15106324 1 Vial

Lentiviral mouse Hsd3b4 shRNA (UAS) - Lentiviral mouse Hsd3b4 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
KAT3A / CBP Rabbit Polyclonal Antibody (BF488)
orb1574383 100 µL

KAT3A / CBP Rabbit Polyclonal Antibody (BF488)

Sign In for Pricing
View Details
PE-Cy7 Rat IgG1 isotype Control
FC1344 100 Tests

PE-Cy7 Rat IgG1 isotype Control

Sign In for Pricing
View Details