Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rabbit TFPI protein

This Rabbit TFPI protein spans the amino acid sequence from region 25-300aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(TFPI) (Extrinsic pathway inhibitor) (EPI) (Lipoprotein-associated coagulation inhibitor) (LACI)

UniProt

P19761

Expression Region

25-300aa

Tag

N-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Oryctolagus cuniculus (Rabbit)

Field of Research

Cell Biology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Rabbit TFPI at 1 μg/mL can bind Anti-TFPI recombinant antibody, the EC50 is 2.281-3.783 ng/mL.

Form

Lyophilized powder

Molecular Weight

35.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

AA Sequence

AAEEDEEFTNITDIKPPLQKPTHSFCAMKVDDGPCRAYIKRFFFNILTHQCEEFIYGGCEGNENRFESLEECKEKCARDYPKMTTKLTFQKGKPDFCFLEEDPGICRGYITRYFYNNQSKQCERFKYGGCLGNLNNFESLEECKNTCENPTSDFQVDDHRTQLNTVNNTLINQPTKAPRRWAFHGPSWCLPPADRGLCQANEIRFFYNAIIGKCRPFKYSGCGGNENNFTSKKACITACKKGFIPKSIKGGLIKTKRKKKKQPVKITYVETFVKKT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Inmt sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K3387008 1.0 µg DNA

Inmt sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Rabbit Monoclonal antibody against CD48
TA310281 100 µL

Rabbit Monoclonal antibody against CD48

Sign In for Pricing
View Details
ADRA1B (Adrenergic, Alpha-1B-, receptor, ADRA1, ALPHA1BAR, OTTHUMP00000160844, Alpha-1B adrenergic receptor, Alpha-1B adrenoceptor, Alpha-1B-adrenergic receptor)
207973 100 µg

ADRA1B (Adrenergic, Alpha-1B-, receptor, ADRA1, ALPHA1BAR, OTTHUMP00000160844, Alpha-1B adrenergic receptor, Alpha-1B adrenoceptor, Alpha-1B-adrenergic receptor)

Sign In for Pricing
View Details
Hsa-miR-4666a-5p miRNA Mimic
CMH1475-01 5 nmol

Hsa-miR-4666a-5p miRNA Mimic

Sign In for Pricing
View Details
Hsa-miR-4666a-5p miRNA Mimic
CMH1475-02 10 nmol

Hsa-miR-4666a-5p miRNA Mimic

Sign In for Pricing
View Details
Dog NT-ProBNP (N-Terminal Pro-Brain Natriuretic Peptide) ELISA Kit
MBS8821199-01 48 Well

Dog NT-ProBNP (N-Terminal Pro-Brain Natriuretic Peptide) ELISA Kit

Sign In for Pricing
View Details