What is the catalog number for Human FCRL6 protein?

The catalog number for Human FCRL6 protein is orb595094.

What sizes are available for Human FCRL6 protein?

Human FCRL6 protein is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Human FCRL6 protein come in?

Human FCRL6 protein is available in 3 different pack sizes.

Is Human FCRL6 protein in stock?

Human FCRL6 protein is currently made to order / not held in immediate stock. Contact us for lead time.

Human FCRL6 protein

This Human FCRL6 protein spans the amino acid sequence from region 20-307aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Fc receptor homolog 6 (FcRH6) (IFGP6)

UniProt

Q6DN72

Expression Region

20-307aa

Tag

N-terminal 10xHis-tagged

Source

Baculovirus

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Extracellular Domain

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LYLQAWPNPVFEGDALTLRCQGWKNTPLSQVKFYRDGKFLHFSKENQTLSMGAATVQSRGQYSCSGQVMYIPQTFTQTSETAMVQVQELFPPPVLSAIPSPEPREGSLVTLRCQTKLHPLRSALRLLFSFHKDGHTLQDRGPHPELCIPGAKEGDSGLYWCEVAPEGGQVQKQSPQLEVRVQAPVSRPVLTLHHGPADPAVGDMVQLLCEAQRGSPPILYSFYLDEKIVGNHSAPCGGTTSLLFPVKSEQDAGNYSCEAENSVSRERSEPKKLSLKGSQVLFTPASNW