Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human FCRL6 protein

This Human FCRL6 protein spans the amino acid sequence from region 20-307aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Fc receptor homolog 6 (FcRH6) (IFGP6)

UniProt

Q6DN72

Expression Region

20-307aa

Tag

N-terminal 10xHis-tagged

Source

Baculovirus

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Extracellular Domain

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LYLQAWPNPVFEGDALTLRCQGWKNTPLSQVKFYRDGKFLHFSKENQTLSMGAATVQSRGQYSCSGQVMYIPQTFTQTSETAMVQVQELFPPPVLSAIPSPEPREGSLVTLRCQTKLHPLRSALRLLFSFHKDGHTLQDRGPHPELCIPGAKEGDSGLYWCEVAPEGGQVQKQSPQLEVRVQAPVSRPVLTLHHGPADPAVGDMVQLLCEAQRGSPPILYSFYLDEKIVGNHSAPCGGTTSLLFPVKSEQDAGNYSCEAENSVSRERSEPKKLSLKGSQVLFTPASNW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Synaptotagmin antibody
70R-51814 100 µL

Synaptotagmin antibody

Sign In for Pricing
View Details
4-Nitrophenyl 2-benzoyl-4,6-O-benzylidene-a-D-mannopyranoside
sc-284390 10 mg

4-Nitrophenyl 2-benzoyl-4,6-O-benzylidene-a-D-mannopyranoside

Sign In for Pricing
View Details
X-Phos sodium ≥98% *omni, 1g
1735-1g 1 g

X-Phos sodium ≥98% *omni, 1g

Sign In for Pricing
View Details
Goat Macrophage chemotactic factor ELISA Kit
MBS745592-01 48 Well

Goat Macrophage chemotactic factor ELISA Kit

Sign In for Pricing
View Details
Goat Macrophage chemotactic factor ELISA Kit
MBS745592-02 96 Well

Goat Macrophage chemotactic factor ELISA Kit

Sign In for Pricing
View Details
Goat Macrophage chemotactic factor ELISA Kit
MBS745592-03 5x 96 Well

Goat Macrophage chemotactic factor ELISA Kit

Sign In for Pricing
View Details