Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human RCVRN protein

This Human RCVRN protein spans the amino acid sequence from region 2-200aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cancer-associated retinopathy protein (Protein CAR) (RCV1)

UniProt

P35243

Expression Region

2-200aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GNSKSGALSKEILEELQLNTKFSEEELCSWYQSFLKDCPTGRITQQQFQSIYAKFFPDTDPKAYAQHVFRSFDSNLDGTLDFKEYVIALHMTTAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVMAIFKMITPEDVKLLPDDENTPEKRAEKIWKYFGKNDDDKLTEKEFIEGTLANKEILRLIQFEPQKVKEKMKNA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELISA Kit For Calponin-1
E1998p 96 Tests

ELISA Kit For Calponin-1

Sign In for Pricing
View Details
C1QL4 sgRNA CRISPR Lentivector set (Human)
K0220201 3x 1.0 µg

C1QL4 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
C14orf151 (INF2) (NM_022489) Human Recombinant Protein
PH35607M5 20 µg

C14orf151 (INF2) (NM_022489) Human Recombinant Protein

Sign In for Pricing
View Details
STNL W015-210x297-PE-CRD/1 Safety & Regulatory Compliance Signs & Labels (Adhesive)
828572 1 Card (1 Panel (s) x 1 Pack)

STNL W015-210x297-PE-CRD/1 Safety & Regulatory Compliance Signs & Labels (Adhesive)

Sign In for Pricing
View Details
GPHN Protein Vector (Rat) (pPB-C-His)
PV270982 500 ng

GPHN Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
CA1 (Carbonic Anhydrase 1, Carbonic Anhydrase I, CA-I, Carbonate Dehydratase I, Carbonic Anhydrase B, CAB) (MaxLight 490)
124176-ML490 100 µL

CA1 (Carbonic Anhydrase 1, Carbonic Anhydrase I, CA-I, Carbonate Dehydratase I, Carbonic Anhydrase B, CAB) (MaxLight 490)

Sign In for Pricing
View Details