Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human RCVRN protein

This Human RCVRN protein spans the amino acid sequence from region 2-200aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cancer-associated retinopathy protein (Protein CAR) (RCV1)

UniProt

P35243

Expression Region

2-200aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GNSKSGALSKEILEELQLNTKFSEEELCSWYQSFLKDCPTGRITQQQFQSIYAKFFPDTDPKAYAQHVFRSFDSNLDGTLDFKEYVIALHMTTAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVMAIFKMITPEDVKLLPDDENTPEKRAEKIWKYFGKNDDDKLTEKEFIEGTLANKEILRLIQFEPQKVKEKMKNA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RTDR1 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV670157 1.0 µg DNA

RTDR1 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
HADHB, CT (HADHB, Trifunctional enzyme subunit beta, mitochondrial, TP-beta, 3-ketoacyl-CoA thiolase, Acetyl-CoA acyltransferase, Beta-ketothiolase) (APC) discontinued
036418-APC 200 µL

HADHB, CT (HADHB, Trifunctional enzyme subunit beta, mitochondrial, TP-beta, 3-ketoacyl-CoA thiolase, Acetyl-CoA acyltransferase, Beta-ketothiolase) (APC) discontinued

Sign In for Pricing
View Details
Mouse Octamer Binding Transcription Factor 4 (OCT4) Antibody Pair Kit (with Standard)
MBS2098913-01 5x 96 Tests

Mouse Octamer Binding Transcription Factor 4 (OCT4) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Mouse Octamer Binding Transcription Factor 4 (OCT4) Antibody Pair Kit (with Standard)
MBS2098913-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)

Mouse Octamer Binding Transcription Factor 4 (OCT4) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Mouse Octamer Binding Transcription Factor 4 (OCT4) Antibody Pair Kit (with Standard)
MBS2098913-03 10x 96 Tests

Mouse Octamer Binding Transcription Factor 4 (OCT4) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Mouse Octamer Binding Transcription Factor 4 (OCT4) Antibody Pair Kit (with Standard)
MBS2098913-04 10x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1, 10x 96 Tests)

Mouse Octamer Binding Transcription Factor 4 (OCT4) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details