Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human RCVRN protein

This Human RCVRN protein spans the amino acid sequence from region 2-200aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cancer-associated retinopathy protein (Protein CAR) (RCV1)

UniProt

P35243

Expression Region

2-200aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GNSKSGALSKEILEELQLNTKFSEEELCSWYQSFLKDCPTGRITQQQFQSIYAKFFPDTDPKAYAQHVFRSFDSNLDGTLDFKEYVIALHMTTAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVMAIFKMITPEDVKLLPDDENTPEKRAEKIWKYFGKNDDDKLTEKEFIEGTLANKEILRLIQFEPQKVKEKMKNA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Interleukin 10 Receptor Alpha (IL10Ra) Antibody
abx173059-01 100 µL

Interleukin 10 Receptor Alpha (IL10Ra) Antibody

Sign In for Pricing
View Details
Interleukin 10 Receptor Alpha (IL10Ra) Antibody
abx173059-02 200 µL

Interleukin 10 Receptor Alpha (IL10Ra) Antibody

Sign In for Pricing
View Details
Interleukin 10 Receptor Alpha (IL10Ra) Antibody
abx173059-03 1 mL

Interleukin 10 Receptor Alpha (IL10Ra) Antibody

Sign In for Pricing
View Details
ICAM3 Antibody
OAEE00269-100UG 0.1 mg (C100)

ICAM3 Antibody

Sign In for Pricing
View Details
Recombinant Actinobacillus pleuropneumoniae serotype 3 Probable ubiquinone biosynthesis protein UbiB (ubiB), partial
MBS7071192 Inquire

Recombinant Actinobacillus pleuropneumoniae serotype 3 Probable ubiquinone biosynthesis protein UbiB (ubiB), partial

Sign In for Pricing
View Details
PTPN6 Recombinant Antibody, PerCP Conjugated
bsm-61171R-PerCP-TR 20 µL

PTPN6 Recombinant Antibody, PerCP Conjugated

Sign In for Pricing
View Details