Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Virus PS/HR protein

This Virus PS/HR protein spans the amino acid sequence from region 18-92aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein B5

UniProt

P24284

Expression Region

18-92aa

Tag

N-terminal MBP-tagged and C-terminal 6xHis-tagged

Source

Baculovirus

Origin

Vaccinia virus (strain LC16m8) (VACV)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

52.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

YSTCTVPTMNNAKLTSTETSFNDKQKVTFTCDQGYHSLDPNAVCETDKWKYENPCKKMCTVSDYVSELYDKPLYK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Cystatin SN (Cys-SN) ELISA Kit
EIA06918m 1 Kit

Mouse Cystatin SN (Cys-SN) ELISA Kit

Sign In for Pricing
View Details
SLC7A4 CRISPR Knock Out 293T Cell Line (Human)
44280141 1x 10^6 Cells / 1.0 mL

SLC7A4 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
Mouse anti-Enterobacteria phage M13 III Monoclonal antibody
MBS9019140-01 0.05 mL

Mouse anti-Enterobacteria phage M13 III Monoclonal antibody

Sign In for Pricing
View Details
Mouse anti-Enterobacteria phage M13 III Monoclonal antibody
MBS9019140-02 0.1 mL

Mouse anti-Enterobacteria phage M13 III Monoclonal antibody

Sign In for Pricing
View Details
Mouse anti-Enterobacteria phage M13 III Monoclonal antibody
MBS9019140-03 5x 0.1 mL

Mouse anti-Enterobacteria phage M13 III Monoclonal antibody

Sign In for Pricing
View Details
Compound NP-023020
MBS5793418 Inquire

Compound NP-023020

Sign In for Pricing
View Details