Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human VSIG1 protein

This Human VSIG1 protein spans the amino acid sequence from region 22-232aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cell surface A33 antigen (Glycoprotein A34) (GPA34)

UniProt

Q86XK7

Expression Region

22-232aa

Tag

N-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Extracellular Domain

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VQVTIPDGFVNVTVGSNVTLICIYTTTVASREQLSIQWSFFHKKEMEPISIYFSQGGQAVAIGQFKDRITGSNDPGNASITISHMQPADSGIYICDVNNPPDFLGQNQGILNVSVLVKPSKPLCSVQGRPETGHTISLSCLSALGTPSPVYYWHKLEGRDIVPVKENFNPTTGILVIGNLTNFEQGYYQCTAINRLGNSSCEIDLTSSHPE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UBTF (Upstream Binding Transcription Factor, RNA Polymerase I, NOR-90, UBF) (MaxLight 550)
MBS6219924-01 0.1 mL

UBTF (Upstream Binding Transcription Factor, RNA Polymerase I, NOR-90, UBF) (MaxLight 550)

Sign In for Pricing
View Details
UBTF (Upstream Binding Transcription Factor, RNA Polymerase I, NOR-90, UBF) (MaxLight 550)
MBS6219924-02 5x 0.1 mL

UBTF (Upstream Binding Transcription Factor, RNA Polymerase I, NOR-90, UBF) (MaxLight 550)

Sign In for Pricing
View Details
NPM1P1 3'UTR Luciferase Stable Cell Line
TU015883 1.0 mL

NPM1P1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
TCRZ Conjugated Antibody
MBS9455830-01 0.1 mL (Biotin)

TCRZ Conjugated Antibody

Sign In for Pricing
View Details
TCRZ Conjugated Antibody
MBS9455830-02 0.1 mL (AF350)

TCRZ Conjugated Antibody

Sign In for Pricing
View Details
TCRZ Conjugated Antibody
MBS9455830-03 0.1 mL (AF405)

TCRZ Conjugated Antibody

Sign In for Pricing
View Details