Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Osm protein

This Rat Osm protein spans the amino acid sequence from region 26-208aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Osm, Oncostatin-M, OSM

UniProt

Q65Z15

Expression Region

26-208aa

Tag

N-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Rattus norvegicus (Rat)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KRGCSSSSPKLLSQLKSQANITGNTASLLEPYILHQNLNTLTLRAACTEHPVAFPSEDMLRQLSKPDFLSTVHATLGRVWHQLGAFRQQFPKIQDFPELERARQNIQGIRNNVYCMARLLHPPLEIPEPTQADSGTSRPTTTAPGIFQIKIDSCRFLWGYHRFMGSVGRVFEEWGDGSRRSRR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sidt2 Mouse shRNA Lentiviral Particle (Locus ID 214597)
TL509500V 500 µL Each

Sidt2 Mouse shRNA Lentiviral Particle (Locus ID 214597)

Sign In for Pricing
View Details
Recombinant Vibrio cholerae serotype O1 Cysteine desulfurase (iscS)
MBS1005478-01 0.05 mg (E-Coli)

Recombinant Vibrio cholerae serotype O1 Cysteine desulfurase (iscS)

Sign In for Pricing
View Details
Recombinant Vibrio cholerae serotype O1 Cysteine desulfurase (iscS)
MBS1005478-02 0.05 mg (Yeast)

Recombinant Vibrio cholerae serotype O1 Cysteine desulfurase (iscS)

Sign In for Pricing
View Details
Recombinant Vibrio cholerae serotype O1 Cysteine desulfurase (iscS)
MBS1005478-03 0.05 mg (Baculovirus)

Recombinant Vibrio cholerae serotype O1 Cysteine desulfurase (iscS)

Sign In for Pricing
View Details
Recombinant Vibrio cholerae serotype O1 Cysteine desulfurase (iscS)
MBS1005478-04 0.2 mg (E-Coli)

Recombinant Vibrio cholerae serotype O1 Cysteine desulfurase (iscS)

Sign In for Pricing
View Details
Recombinant Vibrio cholerae serotype O1 Cysteine desulfurase (iscS)
MBS1005478-05 0.5 mg (E-Coli)

Recombinant Vibrio cholerae serotype O1 Cysteine desulfurase (iscS)

Sign In for Pricing
View Details