Mouse C1qtnf3 protein
This Mouse C1qtnf3 protein spans the amino acid sequence from region 23-246aa. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Collagenous repeat-containing sequence 26 kDa protein Short name, CORS26 Secretory protein CORS26 Ctrp3
UniProt
Q9ES30
Expression Region
23-246aa
Tag
N-terminal 10xHis-tagged
Source
Baculovirus
Origin
Mus musculus (Mouse)
Field of Research
Metabolism Research
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
26.6 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Full Length of Mature Protein
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
QDEYMESPQAGGLPPDCSKCCHGDYGFRGYQGPPGPPGPPGIPGNHGNNGNNGATGHEGAKGEKGDKGDLGPRGERGQHGPKGEKGYPGVPPELQIAFMASLATHFSNQNSGIIFSSVETNIGNFFDVMTGRFGAPVSGVYFFTFSMMKHEDVEEVYVYLMHNGNTVFSMYSYETKGKSDTSSNHAVLKLAKGDEVWLRMGNGALHGDHQRFSTFAGFLLFETK
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LS007259-20ug 20 µg
TSPYL1 (NM_003309) Human Over-expression Lysate
Sign In for Pricing
View Details 
MBS2137652-01 0.1 mL
APC_Cy7 Linked Monoclonal Antibody to Beclin 1 (BECN1)
Sign In for Pricing
View Details MBS2137652-02 0.2 mL
APC_Cy7 Linked Monoclonal Antibody to Beclin 1 (BECN1)
Sign In for Pricing
View Details MBS2137652-03 0.5 mL
APC_Cy7 Linked Monoclonal Antibody to Beclin 1 (BECN1)
Sign In for Pricing
View Details