Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Tnc protein

This Mouse Tnc protein spans the amino acid sequence from region 1884-2099aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Hexabrachion Tenascin-C Short name, TN-C Hxb

UniProt

Q80YX1

Expression Region

1884-2099aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Origin

Mus musculus (Mouse)

Field of Research

Musculoskeletal & Connective Tissue Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GLLYPFPRDCSQAMLNGDTTSGLYTIYINGDKTQALEVYCDMTSDGGGWIVFLRRKNGREDFYRNWKAYAAGFGDRREEFWLGLDNLSKITAQGQYELRVDLQDHGESAYAVYDRFSVGDAKSRYKLKVEGYSGTAGDSMNYHNGRSFSTYDKDTDSAITNCALSYKGAFWYKNCHRVNLMGRYGDNNHSQGVNWFHWKGHEYSIQFAEMKLRPSN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAB40B Conjugated Antibody
orb1622781 100 µL

RAB40B Conjugated Antibody

Sign In for Pricing
View Details
STOM 3'UTR Luciferase Stable Cell Line
TU024837 1.0 mL

STOM 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
IL2RA siRNA (Mouse)
CRM2058-01 15 nmol

IL2RA siRNA (Mouse)

Sign In for Pricing
View Details
IL2RA siRNA (Mouse)
CRM2058-02 30 nmol

IL2RA siRNA (Mouse)

Sign In for Pricing
View Details
ALDH2 Rabbit Polyclonal Antibody (Fluoro488)
orb3077249 100 µg

ALDH2 Rabbit Polyclonal Antibody (Fluoro488)

Sign In for Pricing
View Details
Human Glutathione S Transferase Alpha 5 (GSTa5) ELISA Kit
MBS459749-01 48 Tests

Human Glutathione S Transferase Alpha 5 (GSTa5) ELISA Kit

Sign In for Pricing
View Details