Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Tnc protein

This Mouse Tnc protein spans the amino acid sequence from region 1884-2099aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Hexabrachion Tenascin-C Short name, TN-C Hxb

UniProt

Q80YX1

Expression Region

1884-2099aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Origin

Mus musculus (Mouse)

Field of Research

Musculoskeletal & Connective Tissue Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GLLYPFPRDCSQAMLNGDTTSGLYTIYINGDKTQALEVYCDMTSDGGGWIVFLRRKNGREDFYRNWKAYAAGFGDRREEFWLGLDNLSKITAQGQYELRVDLQDHGESAYAVYDRFSVGDAKSRYKLKVEGYSGTAGDSMNYHNGRSFSTYDKDTDSAITNCALSYKGAFWYKNCHRVNLMGRYGDNNHSQGVNWFHWKGHEYSIQFAEMKLRPSN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SCGB1B2P ORF Vector (Human) (pORF)
ORF032035 1.0 µg DNA

SCGB1B2P ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Ledipasvir hydrochloride
orb1982181-01 25 mg

Ledipasvir hydrochloride

Sign In for Pricing
View Details
Ledipasvir hydrochloride
orb1982181-02 50 mg

Ledipasvir hydrochloride

Sign In for Pricing
View Details
Ledipasvir hydrochloride
orb1982181-03 100 mg

Ledipasvir hydrochloride

Sign In for Pricing
View Details
Anti-CD147/Emmprin Antibody Picoband® (monoclonal, 7H5E7) Fluoro594 Conjugated
M00248-5-Fluoro594 100 µg/Vial

Anti-CD147/Emmprin Antibody Picoband® (monoclonal, 7H5E7) Fluoro594 Conjugated

Sign In for Pricing
View Details
Mouse Kruppel Like Factor 18 ELISA Kit
MBS746657-01 48 Well

Mouse Kruppel Like Factor 18 ELISA Kit

Sign In for Pricing
View Details