Mouse Tnc protein
This Mouse Tnc protein spans the amino acid sequence from region 1884-2099aa. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Hexabrachion Tenascin-C Short name, TN-C Hxb
UniProt
Q80YX1
Expression Region
1884-2099aa
Tag
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Source
Mammalian cell
Origin
Mus musculus (Mouse)
Field of Research
Musculoskeletal & Connective Tissue Research
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
28.8 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Partial
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
GLLYPFPRDCSQAMLNGDTTSGLYTIYINGDKTQALEVYCDMTSDGGGWIVFLRRKNGREDFYRNWKAYAAGFGDRREEFWLGLDNLSKITAQGQYELRVDLQDHGESAYAVYDRFSVGDAKSRYKLKVEGYSGTAGDSMNYHNGRSFSTYDKDTDSAITNCALSYKGAFWYKNCHRVNLMGRYGDNNHSQGVNWFHWKGHEYSIQFAEMKLRPSN
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
orb2459760 100 µL
Syntaxin 1A + Syntaxin 1B Rabbit Polyclonal Antibody (PerCP-Cy5.5)
Sign In for Pricing
View Details MBS6339534-01 0.1 mL
RAB11FIP2, ID (RAB11FIP2, KIAA0941, Rab11 family-interacting protein 2, NRip11) (MaxLight 750)
Sign In for Pricing
View Details MBS6339534-02 5x 0.1 mL
RAB11FIP2, ID (RAB11FIP2, KIAA0941, Rab11 family-interacting protein 2, NRip11) (MaxLight 750)
Sign In for Pricing
View Details 
328905-01 50 µg
Phospho-LKB1 (S428) (STK11, LKB1, PJS, Serine/threonine- Protein kinase STK11, Liver kinase B1, LKB1, hLKB1, Renal carcinoma Antigen NY-REN-19)
Sign In for Pricing
View Details 328905-02 100 µg
Phospho-LKB1 (S428) (STK11, LKB1, PJS, Serine/threonine- Protein kinase STK11, Liver kinase B1, LKB1, hLKB1, Renal carcinoma Antigen NY-REN-19)
Sign In for Pricing
View Details