Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Sprr2b protein

This Mouse Sprr2b protein spans the amino acid sequence from region 1-98aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Sprr2bSmall proline-rich protein 2B

UniProt

O70554

Expression Region

1-98aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Origin

Mus musculus (Mouse)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSYYQQQCKQPCQPPPVCPPPKCPEPCPPPKCPEPCPPPVCCEPCPPPKCPEPCPPPVCCEPCPPPVCCEPCPPQPWQPKCPPVQFPPCQQKCPPKNK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

THAP1 siRNA (Human)
MBS8217660-01 15 nmol

THAP1 siRNA (Human)

Sign In for Pricing
View Details
THAP1 siRNA (Human)
MBS8217660-02 30 nmol

THAP1 siRNA (Human)

Sign In for Pricing
View Details
THAP1 siRNA (Human)
MBS8217660-03 5x 30 nmol

THAP1 siRNA (Human)

Sign In for Pricing
View Details
Anti-Glutathione Peroxidase 1 (Mouse, Monoclonal)
A113697 100 µL

Anti-Glutathione Peroxidase 1 (Mouse, Monoclonal)

Sign In for Pricing
View Details
Mouse Galc qPCR Primer Pair
QM13534S 200 Tests

Mouse Galc qPCR Primer Pair

Sign In for Pricing
View Details
Monkey Protein TBRG4 (TBRG4) ELISA Kit
MBS7263070-01 48 Well

Monkey Protein TBRG4 (TBRG4) ELISA Kit

Sign In for Pricing
View Details